服务热线
400-021-2200

现货供应,欢迎订购: :
CD14 Human Recombinant HEK
10µg
50µg
1mg
Catalogue Number
PRO-1642
Synonyms Monocyte
differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14.
Introduction
CD14 (also known lipopolysaccharide (LPS) receptor) is expressed strongly on monocytes and macrophage and weakly on the surface of neutrophils. CD14 is anchored to cells by linkage to glycosylphosphatidylinositol (GPI) and functions as a high affinity receptor for complexes of LPS and LPS binding protein (LBP). Soluble CD14, also binding to LPS, acts at physiological concentration as an LPS agonist and has, at higher concentrations, an LPS antagonizing effect in cell activation. CD14 has been shown to bind apoptotic cells.
Description
CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.
Source
HEK293 cells.
Physical Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation
CD14 was lyophilized from a 0.2 µM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.
Solubility
It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Stability
Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
Purity
Greater than 95% as determined by SDS-PAGE.
Amino acid sequence TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVD
ADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKIT
GTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELWLKPGLKVLSIAQAHSPAF
SCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCA
ALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKL
RVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH
Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. Related Products CHEMOKINES
Related Products
ABI3 pro-1227 Recombinant Human ABI Family, Member 3
A2LD1 pro-172 Recombinant Human AIG2-Like Domain 1
A2M pro-551 Human Alpha-2 Macroglobulin Protein
ACTA2 pro-1220 Recombinant Human Actin, Alpha 2, Smooth Muscle, Aorta
ACTG1 pro-377 Recombinant Human Actin Gamma 1
Actin pro-517 Actin
ACTL6A pro-379 Recombinant Human Actin-Like 6A
ADAM10 pro-476 Recombinant Human A Disintegrin and Metalloproteinase Domain 10
ADAM12 pro-474 Recombinant Human A Disintegrin and Metalloproteinase Domain 12 S Isoform
ADFP pro-405 Recombinant Human Adipose Differentiation-Related Protein
Adipsin pro-1360 Recombinant Human Complement Factor D
ADRM1 pro-1079 Recombinant Human Adhesion Regulating Molecule 1
AES pro-169 Recombinant Human Amino-Terminal Enhancer of Split
AFP pro-406 Human Alpha Fetoprotein
Ag85A pro-1076 Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85A
Ag85B pro-589 Recombinant Mycobacterium Tuberculosis major secretory protein Antigen 85B
AGR2 pro-580 Recombinant Human Anterior Gradient Protein 2 Homolog
AGR3 pro-242 Recombinant Human Anterior Gradient Protein 3 Homolog
AHSP pro-720 Recombinant Human Alpha Hemoglobin Stabilizing Protein
AIDA pro-1370 Recombinant Human Axin Interactor Dorsalization Associated
AIP pro-886 Recombinant Human Aryl Hydrocarbon Receptor Interacting Protein
ALK/P80 pro-455 Recombinant Human ALK-P80
Alpha Actinin pro-518 Alpha Actinin
AMBP pro-407 Human Alpha-1 Microglobulin
AMBP pro-957 Recombinant Human Alpha-1 Microglobulin
AMELX pro-1324 Recombinant Human Amelogenin, X-Linked
AMN pro-1330 Recombinant Human Amnion Associated Transmembrane Protein
AMTN pro-1301 Recombinant Human Amelotin
ANAPC13 pro-1037 Recombinant Human Anaphase Promoting Complex Subunit 13
Angiostatin K1-3 pro-284 Recombinant Human Angiostatin Kringles 1-3
Angiostatin K1-4 pro-604 Human Angiostatin Kringles 1-4
ANKRD1 pro-1219 Recombinant Human Ankyrin Repeat Domain 1
ANP32A pro-252 Recombinant Human Acidic Nuclear Phosphoprotein 32 Family, Member A
ANXA1 pro-679 Recombinant Human Annexin A1
ANXA10 pro-1045 Recombinant Human Annexin A10
ANXA11 pro-278 Recombinant Human Annexin A11
ANXA13 pro-197 Recombinant Human Annexin A13
ANXA2 pro-777 Recombinant Human Annexin A2
ANXA3 pro-765 Recombinant Human Annexin A3
ANXA4 pro-766 Recombinant Human Annexin A4
ANXA5 pro-732 Recombinant Human Annexin A5
ANXA5 Sf9 pro-137 Recombinant Human Annexin A5, Sf9
ANXA6 pro-767 Recombinant Human Annexin A6
ANXA7 pro-449 Recombinant Human Annexin A7
ANXA8 pro-548 Recombinant Human Annexin A8
ANXA8L2 pro-1138 Recombinant Human Annexin A8 Like-2
ANXA9 pro-450 Recombinant Human Annexin A9
AP1S2 pro-234 Recombinant Human Adaptor-Related Protein Complex 1, Sigma 2
AP2M1 pro-451 Recombinant Human Assembly Protein Complex 2
AP3S1 pro-1280 Recombinant Human Assembly Protein Complex 3 Subunit-1
AP3S2 pro-452 Recombinant Human Assembly Protein Complex 3 Subunit-2
APCS pro-453 Recombinant Human Amyloid P Component
APIP pro-1186 Recombinant Human APAF1 interacting protein
Apo Transferrin pro-325 Human Apo Transferrin
APP pro-1080 Recombinant Human Amyloid beta (A4) Precursor Protein
bApo Transferrin pro-511 Bovine Apo Transferrin
bAprotinin pro-285 Bovine Aprotinin
bAprotinin pro-414 Recombinant Bovine Aprotinin
APTX pro-790 Recombinant Human Aprataxin
ARC pro-1403 Recombinant Human Activity-Regulated Cytoskeleton-Associated Protein
ARF1 pro-867 Recombinant Human ADP-Ribosylation Factor 1
ARF3 pro-933 Recombinant Human ADP-Ribosylation Factor 3
ARF4 pro-066 Recombinant Human ADP-Ribosylation Factor 4
ARF5 pro-245 Recombinant Human ADP-Ribosylation Factor 5
ARF6 pro-032 Recombinant Human ADP-Ribosylation Factor 6
ARFIP2 pro-1201 Recombinant Human ADP-Ribosylation Factor Interacting Protein 2
ARHGDIA pro-002 Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Alpha
ARHGDIB pro-1067 Recombinant Human Rho GDP Dissociation Inhibitor (GDI) Beta
ARL1 pro-508 Recombinant Human ADP-Ribosylation Factor-Like 1
ARL11 pro-884 Recombinant Human ADP-Ribosylation Factor-Like 11
ARL14 pro-936 Recombinant Human ADP-Ribosylation Factor-Like 14
ARL15 pro-956 Recombinant Human ADP-Ribosylation Factor-Like 15
ARL2 pro-074 Recombinant Human ADP-Ribosylation Factor-Like 2
ARL2BP pro-274 Recombinant Human ADP-Ribosylation Factor-Like 2 Binding Protein
ARL3 pro-939 Recombinant Human ADP-Ribosylation Factor-Like 3
ARL4A pro-895 Recombinant Human ADP-Ribosylation Factor-Like 4A
ARL4D pro-953 Recombinant Human ADP-Ribosylation Factor-Like 4D
ARL5A pro-040 Recombinant Human ADP-Ribosylation Factor-Like 5A
ARL5B pro-897 Recombinant Human ADP-Ribosylation Factor-Like 5B
ARL6 pro-232 Recombinant Human ADP-Ribosylation Factor-Like 6
ARL9 pro-1009 Recombinant Human ADP-Ribosylation Factor-Like 9
ARPC2 pro-1398 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 2
ARPC5 pro-145 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 5
ARPC3 pro-1413 Recombinant Human Actin Related Protein 2/3 Complex, Subunit 3
ASF1A pro-682 Recombinant Human ASF1 Anti-Silencing Function 1 Homolog A
ASF1B pro-1163 Recombinant Human ASF1 Anti-Silencing Function 1 Homolog B
ASGR2 pro-1261 Recombinant Human Asialoglycoprotein Receptor 2
ASNA1 pro-1247 Recombinant Human arsA Arsenite Transporter, ATP-Binding, Homolog 1
ATG10 pro-1234 Recombinant Human Autophagy Related 10
ATG4B pro-1048 Recombinant Human ATG4 Autophagy Related 4 Homolog B
ATG5 pro-454 Recombinant Human Autophagy Related 5
ATOH1 pro-1073 Recombinant Human Atonal Homolog 1
ATOX1 pro-754 Recombinant Human Copper Transport Protein ATOX1
ATPIF1 pro-1154 Recombinant Human ATPase Inhibitory Factor 1
ATXN3 pro-708 Recombinant Human Ataxin-3
Avidin pro-500 Avidin
Avidin-Biotin pro-446 Modified Affinity Purified Avidin
B2GP1 pro-388 Recombinant Human Beta 2 Glycoprotein-I
B2GP1 pro-552 Human Beta 2 Glycoprotein-I
B2M pro-337 Recombinant Human Beta 2 Microglobulin
B2M pro-553 Human Beta 2 Microglobulin
B2M His pro-859 Recombinant Human Beta 2 Microglobulin, His Tag
BAALC pro-758 Recombinant Human Brain and Acute Leukemia, Cytoplasmatic
BAD pro-458 Recombinant Human BAD
BAG1 pro-817 Recombinant Human BCL2-Associated Athanogene 1
BAG2 pro-168 Recombinant Human BCL2-Associated Athanogene 2
BAG3 pro-760 Recombinant Human BCL2-Associated Athanogene 3
BAIAP2 pro-1022 Recombinant Human BAI1-Associated Protein 2
BASP1 pro-1355 Recombinant Human Brain Abundant Membrane Attached Signal Protein 1
BATF pro-119 Recombinant Human Basic Leucine Zipper Transcription Factor
Batroxobin pro-607 Recombinant Batroxobin
mBAX pro-412 Recombinant Mouse Bax
mBAX GST pro-647 Recombinant Mouse Bax GST Tag
bCAPN2 pro-330 Bovine Calpain-2 Catalytic Subunit
BCAS2 pro-116 Recombinant Human Breast Carcinoma Amplified Sequence 2
BCDIN3D pro-1262 Recombinant Human BCDIN3D
BCL10 pro-1058 Recombinant Human B-cell CLL/Lymphoma 10
Bcl-2 pro-630 Recombinant Human B-Cell Leukemia/Lymphoma 2
Bcl-2 -BH1 pro-631 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH1
Bcl-2 -BH2 pro-632 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH2
Bcl-2 -BH3 pro-633 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH3
Bcl-2 -BH4 pro-411 Recombinant Human B-Cell Leukemia/Lymphoma 2 -BH4
BCL2 His pro-683 Recombinant Human B-Cell Lymphoma Protein 2 Alpha, His Tag
Bcl-2 -NWGR pro-634 Recombinant Human B-Cell Leukemia/Lymphoma 2 -NWGR
BCL2A1 pro-1102 Recombinant Human BCL2-Related Protein A1
BCL2L10 pro-1321 Recombinant Human BCL2 Like 10
BCL2L11 pro-1171 Recombinant Human BCL2 Like 11
BCL2L2 pro-768 Recombinant Human BCL2 Like 2
BCL6 pro-460 Recombinant Human B-cell CLL/lymphoma 6
BCL7A pro-1318 Recombinant Human B-cell CLL/lymphoma 7A
Bcl-XL pro-639 Recombinant Human B-Cell Leukemia/Lymphoma XL
Bcl-XL GST pro-640 Recombinant Human B-Cell Leukemia/Lymphoma XL GST Tag
Bcl-XL His pro-641 Recombinant Human B-Cell Leukemia/Lymphoma His Tag
mBcl-XL pro-1362 Recombinant Mouse B-Cell Leukemia/Lymphoma XL
bECGS pro-603 Bovine Endothelial Mitogen
BECN1 pro-1289 Recombinant Human Beclin 1, Autophagy Related
BGN pro-1382 Recombinant Human Biglycan
bFibronectin pro-059 Bovine Fibronectin
bHolo Transferrin pro-510 Bovine Holo Transferrin
BID pro-627 Recombinant Human BH3 Interacting Domain Death Agonist
mBID pro-642 Recombinant Mouse BH3 Interacting Domain Death Agonist
mBID GST pro-643 Recombinant Mouse BH3 Interacting Domain Death Agonist GST
mtBID pro-644 Recombinant Mouse BH3 Interacting Domain Death Agonist p15
BIN1 pro-546 Recombinant Human Bridging Integrator 1
BIRC5 pro-613 Recombinant Human Baculoviral IAP Repeat-Containing 5
BIRC7 pro-612 Recombinant Human Baculoviral IAP Repeat-Containing 7
BIRC7 (1-280) pro-1042 Recombinant Human Baculoviral IAP Repeat-Containing 7 (1-280 a.a.)
Bivalirudin pro-357 Human Bivalirudin
BLNK pro-102 Recombinant Human B-Cell Linker
BLOC1S2 pro-1094 Recombinant Human Biogenesis of Lysosomal Organelles Complex-1, Subunit 2
BMF pro-700 Recombinant Human Bcl2 Modifying Factor, Isoform 3
bNEFM pro-523 Bovine Neurofilament Medium Polypeptide
BOLA1 pro-302 Recombinant Human BolA Homolog 1
BP-1 pro-463 Recombinant Human BP-1
BPI pro-129 Human Bactericidal/Permeability-Increasing Protein
BPIFA1 pro-404 Recombinant Human BPI fold containing family A Member 1
BSA pro-422 Bovine Serum Albumin
bSNRPD pro-998 Bovine Small Nuclear Ribonucleoprotein Polypeptide
BTF3 pro-1333 Recombinant Human Basic Transcription Factor 3
BUB3 pro-023 Recombinant Human BUB3
bThrombin pro-447 Bovine Thrombin
bTROVE2 pro-111 Bovine TROVE Domain Family, Member 2
bTrypsin pro-313 Recombinant Bovine Trypsin
bVimentin pro-525 Bovine Vimentin
C7ORF49 pro-1415 Recombinant Human Chromosome 7 Open Reading Frame 49
C12ORF5 pro-051 Recombinant Human Chromosome 12 Open Reading Frame 5
C14ORF129 pro-193 Recombinant Human Chromosome 14 Open Reading Frame 129
C16ORF53 pro-225 Recombinant Human Chromosome 16 Open Reading Frame 53
C17ORF49 pro-1192 Recombinant Human Chromosome 17 Open Reading Frame 49
C1q pro-554 Human Complement Component C1q
C1QBP pro-636 Recombinant Human Complement Component 1
C1QTNF1 pro-654 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 1
C1QTNF2 pro-133 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 2
C1QTNF3 pro-653 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 3
C1QTNF6 pro-655 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 6
C1QTNF7 pro-514 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 7
C1QTNF8 pro-134 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 8
C1QTNF9 pro-135 Recombinant Human Complement C1q Tumor Necrosis Factor-Related Protein 9
C20ORF20 pro-1000 Recombinant Human Chromosome 20 Open Reading Frame 20
C3c pro-555 Human Complement Component C3c
C4BPB pro-1174 Recombinant Human Complement Component 4 Binding Protein, Beta
C4c pro-556 Human Complement Component C4c
mC5a pro-085 Recombinant Mouse Complement Component C5a
C6ORF108 pro-249 Recombinant Human Chromosome 6 Open Reading Frame 108
C8G pro-947 Recombinant Human Complement Component 8, Gamma
C9ORF103 pro-1025 Recombinant Human Chromosome 9 Open Reading Frame 103
C9ORF95 pro-1116 Recombinant Human Chromosome 9 Open Reading Frame 95
CAB39 pro-857 Recombinant Human Calcium Binding Protein 39
CAB39L pro-020 Recombinant Human Calcium Binding Protein 39 Like
CABP7 pro-211 Recombinant Human Calcium Binding Protein 7
CACYBP pro-831 Recombinant Human Calcyclin Binding Protein
Cadherin-E pro-461 Recombinant Human Cadherin-E
CALB1 pro-721 Recombinant Human Calbindin-1
CALB2 pro-401 Recombinant Human Calbindin-2
mCALB2 pro-290 Recombinant Mouse Calbindin-2
CALM2 pro-618 Recombinant Human Calmodulin-2
CALM2 135 a.a. pro-370 Recombinant Human Calmodulin-2 135 a.a.
CALML3 pro-1323 Recombinant Human Calmodulin Like 3
CALN1 pro-279 Recombinant Human Calnueron-1
CALR pro-813 Recombinant Human Calreticulin
Calumenin pro-696 Recombinant Human Calumenin
CAMP pro-1405 Recombinant Human Cathelicidin Antimicrobial Peptide
CANT1 pro-1010 Recombinant Human Calcium Activated Nucleotidase 1
CANX pro-725 Recombinant Human Calnexin
CAPG pro-759 Recombinant Human Capping Protein Gelsolin-Like
CAPN1 pro-363 Human Calpain-1 Catalytic Subunit
CAPS pro-117 Recombinant Human Calcyphosine
CAPSL pro-185 Recombinant Human Calcyphosine-Like
CARD18 pro-1061 Recombinant Human Caspase Recruitment Domain Family, Member 18
Cardiac Actin pro-519 Cardiac Actin
CARHSP1 pro-257 Recombinant Human Calcium Regulated Heat Stable Protein 1
CASQ2 pro-799 Recombinant Human Calsequestrin
CBFB pro-534 Recombinant Human Core Binding Factor Beta
CBX1 pro-876 Recombinant Human Chromobox Homolog 1
CBX3 pro-1057 Recombinant Human Chromobox Homolog 3
CBX5 pro-1062 Recombinant Human Chromobox Homolog 5
CCDC43 pro-1398 Recombinant Human Coiled-Coil Domain Containing 43
CCDC101 pro-1063 Recombinant Human Coiled-Coil Domain Containing 101
CCND2 pro-1012 Recombinant Human Cyclin D2
CCNG1 pro-1005 Recombinant Human Cyclin G1
CCS pro-251 Recombinant Human Copper Chaperone for Superoxide Dismutase
CD11b pro-472 Recombinant Human CD11b
CD14-CHO pro-536 Recombinant Human CD14 CHO derived
mCD14 pro-537 Recombinant Mouse CD14
CD1B pro-1267 Recombinant Human CD1B
CD2 pro-1337 Recombinant Human CD2
CD2 GST pro-468 Recombinant Human CD2, GST Tag
CD23 pro-470 Recombinant Human CD23
CD226 pro-1353 Recombinant Human CD226
CD244 pro-1173 Recombinant Human CD244
CD247 pro-1335 Recombinant Human CD247
CD27 pro-1213 Recombinant Human CD27
CD274 pro-1103 Recombinant Human CD274
mCD274 pro-1164 Recombinant Mouse CD274
CD300C pro-273 Recombinant Human CD300C
CD30 pro-1369 Recombinant Human CD30
CD3G pro-1392 Recombinant Human CD3 Gamma
CD34 GST pro-292 Recombinant Human CD34 GST Tag
CD34 pro-1363 Recombinant Human CD34
CD3e pro-1317 Recombinant Human CD3e
CD45 pro-482 Recombinant Human CD45
CD46 pro-1414 Recombinant Human CD46
CD56 pro-483 Recombinant Human CD56
CD68 pro-1209 Recombinant Human CD68
CD68, 38 kda pro-293 Recombinant Human CD68, 38kda
CD72 pro-486 Recombinant Human CD72
CD79B pro-1304 Recombinant Human CD79B
CD83 pro-019 Recombinant Human CD83
CD84 pro-1229 Recombinant Human CD84
CD95 His pro-594 Recombinant Human CD95, His Tag
CD99 pro-294 Recombinant Human CD99
CDC26 pro-241 Recombinant Human Cell Division Cycle 26
CDC37 pro-464 Recombinant Human Cell Division Cycle 37
CDC37, His pro-140 Recombinant Human Cell Division Cycle 37, His Tag
CDC42 pro-727 Recombinant Human Cell Division Cycle 42
CDCA8 pro-222 Recombinant Human Cell Division Cycle Associated 8
CDH11 pro-1368 Recombinant Human Cadherin 11
CEA pro-287 Recombinant Human Carcinoembryonic Antigen
CEBP-a pro-433 Recombinant Human CCAAT/enhancer binding protein(C/EBP) Alpha
CEBP-g pro-434 Recombinant Human CCAAT/enhancer binding protein(C/EBP) Gamma
CENPA pro-389 Recombinant Human Centromere Protein-A
CENPB pro-390 Recombinant Human Centromere Protein-B
CENPH pro-966 Recombinant Human Centromere Protein-H
CETN1 pro-1104 Recombinant Human Centrin-1
CETN2 pro-060 Recombinant Human Centrin-2
CETN3 pro-533 Recombinant Human Centrin-3
CFL1 pro-591 Recombinant Human Cofilin-1
CFL2 pro-912 Recombinant Human Cofilin-2
CFLAR pro-920 Recombinant Human CASP8 and FADD-Like Apoptosis Regulator
CHD4 pro-112 Recombinant Human Chromodomain Helicase DNA Binding Protein 4
CHGA pro-692 Recombinant Human Chromogranin A
CHGA GST pro-491 Recombinant Human Chromogranin A GST Tag
CHGA His pro-699 Recombinant Human Chromogranin A His Tag
CHGB pro-824 Recombinant Human Chromogranin B
CHMP1A pro-1308 Recombinant Human Chromatin Modifying Protein 1A
CHMP1B pro-1117 Recombinant Human Charged Multivesicular Body Protein 1B
CHMP2A pro-503 Recombinant Human Chromatin Modifying Protein 2A
CHMP2B pro-877 Recombinant Human Chromatin Modifying Protein 2B
CHMP4A pro-1024 Recombinant Human Chromatin Modifying Protein 4A
CHMP5 pro-1232 Recombinant Human Charged Multivesicular Body Protein 5
CHMP6 pro-1085 Recombinant Human Charged Multivesicular Body Protein 6
CHP1 pro-847 Recombinant Human Calcium Binding Protein P22
CHRAC1 pro-1391 Recombinant Human Chromatin Accessibility Complex 1
CIAO1 pro-1396 Recombinant Human Cytosolic Iron-Sulfur Protein Assembly 1
CIAPIN1 pro-024 Recombinant Human Cytokine Induced Apoptosis Inhibitor 1
CIRBP pro-746 Recombinant Human Cold Inducible RNA Binding Protein
CISD1 pro-1221 Recombinant Human CDGSH Iron Sulfur Domain 1
CITED2 pro-701 Recombinant Human Cbp/p300-Interacting Transactivator 2
CLDN4 pro-203 Recombinant Human Claudin-4
CLEC2B pro-526 Recombinant Human C-type Lectin Domain Family 2, Member B
CLIC1 pro-833 Recombinant Human Chloride Intracellular Channel 1
CLIC2 pro-198 Recombinant Human Chloride Intracellular Channel 2
CLIC4 pro-173 Recombinant Human Chloride Intracellular Channel 4
CLNS1A pro-1277 Recombinant Human Chloride Channel, Nucleotide-Sensitive, 1A
CLTA pro-1144 Recombinant Human Clathrin, Light Chain A
CLTB pro-1172 Recombinant Human Clathrin, Light Chain B
CNBP pro-1371 Recombinant Human Cellular Nucleic Acid Binding Protein
CNN1 pro-1129 Recombinant Human Calponin 1, Basic, Smooth Muscle
CNPY3 pro-1386 Recombinant Human Canopy 3 Homolog
mCNOT7 pro-908 Recombinant Mouse CCR4-NOT Transcription Complex, Subunit 7
CNRIP1 pro-1214 Recombinant Human Cannabinoid Receptor Interacting Protein 1
COL4A3 pro-387 Recombinant Human Collagen Type IV Alpha 3
COL4A3BP pro-837 Recombinant Human Collagen Type IV Alpha 3 Binding Protein
Collagen pro-359 Recombinant Human Like Collagen
Collagen-3 pro-480 Recombinant Human Collagen-3
COMMD1 pro-862 Recombinant Human Copper Metabolism Domain Containing 1
COMMD9 pro-1244 Recombinant Human COMM Domain Containing 9
COMP HEK pro-132 Recombinant Human Cartilage Oligomeric Matrix Protein, HEK
COPS8 pro-983 Recombinant Human COP9 Constitutive Photomorphogenic 8
COPZ1 pro-221 Recombinant Human Coatomer Protein Complex, Subunit Zeta 1
COTL1 pro-064 Recombinant Human Coactosin-Like 1
COX4NB pro-917 Recombinant Human COX4NB
COX5A pro-1331 Recombinant Human Cytochrome C Oxidase Subunit Va
CPLX1 pro-645 Recombinant Human Complexin-1
CPSF4 pro-1406 Recombinant Human Cleavage And Polyadenylation Specific Factor 4
CRABP1 pro-710 Recombinant Human Cellular Retinoic Acid Binding Protein 1
CRABP2 pro-637 Recombinant Human Cellular Retinoic Acid binding Protein 2
CRADD pro-465 Recombinant Human Caspase and RIP Adapter with Death Domain
CRCP pro-919 Recombinant Human CGRP Receptor Component
CREG1 pro-1196 Recombinant Human Cellular Repressor of E1A-Stimulated Genes 1
CRIPT pro-1105 Recombinant Human Cysteine-Rich PDZ-Binding Protein
CRISP1 pro-473 Recombinant Human Cysteine-Rich Secretory Protein 1
CRK pro-275 Recombinant Human V-crk Sarcoma Virus CT10 Oncogene
CRKL pro-063 Recombinant Human V-crk Sarcoma Virus CT10 Oncogene Homolog (Avian)-Like
CRMP-1 pro-493 Recombinant Human Collapsin Response Mediator Protein-1
CRNN pro-797 Recombinant Human Cornulin
CRP pro-335 Recombinant Human C-Reactive Protein
CRP pro-557 Human C-Reactive Protein
CRP (19-224 a.a.) pro-914 Recombinant Human C-Reactive Protein (19-224 a.a.)
CRYGC pro-1095 Recombinant Human Crystallin, Gamma C
CRYGD pro-913 Recombinant Human Crystallin, Gamma D
CRYGN pro-1152 Recombinant Human Crystallin, Gamma N
CRYGS pro-963 Recombinant Human Crystallin, Gamma S
CSN2 pro-1047 Recombinant Human Casein Beta
CSRP2 pro-1096 Recombinant Human Cysteine and Glycine-rich Protein 2
CST1 pro-1006 Recombinant Human Cystatin SN
CST3 pro-656 Recombinant Human Cystatin C
CST3 pro-413 Human Cystatin C
mCST3 pro-597 Recombinant Mouse Cystatin-C
rCST3 pro-438 Recombinant Rat Cystatin C
CST3 Active pro-961 Recombinant Human Cystatin C Active
CST4 pro-1097 Recombinant Human Cystatin 4
CST6 pro-892 Recombinant Human Cystatin E/M
CST9 pro-955 Recombinant Human Cystatin 9
CSTA pro-086 Recombinant Human Cystatin-A
CSTA GST pro-543 Recombinant Human Cystatin-A, GST tag
CSTA His pro-504 Recombinant Human Cystatin-A His Tag
CSTB pro-609 Recombinant Human Cystatin-B
CSTF1 pro-1170 Recombinant Human Cleavage Stimulation Factor 1
CTBP1 pro-796 Recombinant Human C-Terminal Binding Protein 1
CTNNBIP1 pro-850 Recombinant Human Catenin, Beta Interacting Protein 1
CUL1 pro-268 Recombinant Human Cullin-1
CUTA pro-812 Recombinant Human CutA Divalent Cation Tolerance Homolog
CUTC pro-911 Recombinant Human cutC Copper Transporter Homolog
CYB5A pro-910 Recombinant Human Cytochrome B5 Type A
CYB5R3 pro-1026 Recombinant Human Cytochrome B5 Reductase 3
Cyclosporin-A pro-408 Cyclosporin-A
CYGB pro-842 Recombinant Human Cytoglobin
Cys-Protein-G His pro-1238 Recombinant Cys-Protein G His Tag
CYTH2 pro-1248 Recombinant Human Cytohesin 2
D4GDI pro-296 Recombinant Human D4-GDI
DBI pro-832 Recombinant Human Diazepam Binding Inhibitor
DBNDD1 pro-1162 Recombinant Human Dysbindin (Dystrobrevin Binding Protein 1) Domain Containing 1
DBNDD2 pro-1167 Recombinant Human Dysbindin (Dystrobrevin Binding Protein 1) Domain Containing 2
DCAF7 pro-909 Recombinant Human DDB1 and CUL4 Associated Factor 7
dCASQ2 pro-410 Dog Calsequestrin-2
DCUN1D1 pro-078 Recombinant Human DCN1 Defective in Cullin Neddylation 1 Domain Containing 1
DCUN1D2 pro-899 Recombinant Human DCN1 Defective in Cullin Neddylation 1 Domain Containing 2
DDIT3 pro-638 Recombinant Human DNA Damage Inducible Transcript 3
DDIT4 pro-094 Recombinant Human DNA Damage Inducible Transcript 4
DEDD pro-1349 Recombinant Human Death Effector Domain Containing
DENR pro-926 Recombinant Human Density-Regulated Protein
Desmin pro-520 Recombinant Human Desmin
DFFA pro-718 Recombinant Human DNA Fragmentation Factor Subunit Alpha
DGCR6 pro-1372 Recombinant Human DiGeorge Syndrome Critical Region Gene 6
DIRAS1 pro-256 Recombinant Human DIRAS family, GTP-binding RAS-like 1
DKK1 pro-673 Recombinant Human Dickkopf-Related Protein 1
DKK1 HEK pro-815 Recombinant Human Dickkopf-Related Protein 1 HEK
DKK2 pro-1205 Recombinant Human Dickkopf-Related Protein 2
DKK3 pro-1175 Recombinant Human Dickkopf-Related Protein 3
DNAL1 pro-1357 Recombinant Human Dynein Axonemal Light Chain 1
DNAL4 pro-227 Recombinant Human Dynein Axonemal Light Chain 4
DPPA3 pro-1291 Recombinant Human Developmental Pluripotency Associated 3
DR1 pro-542 Recombinant Human Down-Regulator of Transcription 1
DRG1 pro-885 Recombinant Human Developmentally Regulated GTP Binding Protein 1
DSTN pro-1137 Recombinant Human Destrin
DTNBP1 pro-675 Recombinant Human Dystrobrevin-Binding Protein 1 Isoform C
DYNLL1 pro-262 Recombinant Human Dynein Light Chain LC8 Type-1
DYNLL2 pro-235 Recombinant Human Dynein Light Chain LC8 Type-2
DYNLRB1 pro-489 Recombinant Human Dynein Light Chain Roadblock-Type 1
DYNLRB2 pro-174 Recombinant Human Dynein Light Chain Roadblock-Type 2
DYNLT1 pro-757 Recombinant Human Dynein, Light Chain, Tctex-Type 1
DYNLT3 pro-1197 Recombinant Human Dynein, Light Chain, Tctex-Type 3
EBAG9 pro-343 Recombinant Human Estrogen Receptor Binding Site Associated Antigen 9
ECSIT pro-1241 Recombinant Human ECSIT homolog
EDF1 pro-494 Recombinant Human Endothelial Differentiation-Related Factor 1
EEF1B2 pro-167 Recombinant Human Eukaryotic Translation Elongation Factor 1 Beta 2
EEF1D pro-170 Recombinant Human Eukaryotic Translation Elongation Factor 1 Delta
EEF1E1 pro-199 Recombinant Human Eukaryotic Translation Elongation Factor 1 Epsilon 1
EFNA1 pro-971 Recombinant Human Ephrin A1
EFNA4 pro-498 Recombinant Human Ephrin A4
EFNB1 pro-918 Recombinant Human Ephrin- B1
EFNB2 pro-937 Recombinant Human Ephrin- B2
EFNB3 pro-1169 Recombinant Human Ephrin- B3
EGLN3 pro-1143 Recombinant Human Egl Nine Homolog 3
EIF1 pro-773 Recombinant Human Eukaryotic Translation Initiation Factor 1
EIF1AX pro-253 Recombinant Human Eukaryotic Translation Initiation Factor 1A X-linked
EIF1AY pro-098 Recombinant Human Eukaryotic Translation Initiation Factor 1A Y-linked
EIF1B pro-175 Recombinant Human Eukaryotic Translation Initiation Factor 1B
EIF2B1 pro-209 Recombinant Human Eukaryotic Translation Initiation Factor 2B Subunit 1 Alpha
EIF2S1 pro-845 Recombinant Human Eukaryotic Translation Initiation Factor 2 Subunit 1 Alpha
EIF3J pro-970 Recombinant Human Eukaryotic Translation Initiation Factor 3J
EIF3K pro-179 Recombinant Human Eukaryotic Translation Initiation Factor 3K
EIF4A3 pro-1007 Recombinant Human Eukaryotic Translation Initiation Factor 4A3
EIF4E pro-530 Recombinant Human Eukaryotic Translation Initiation Factor 4E
EIF4EBP1 pro-532 Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 1
EIF4EBP2 pro-176 Recombinant Human Eukaryotic Translation Initiation Factor 4E-Binding Protein 2
EIF4H pro-1114 Recombinant Human Eukaryotic Translation Initiation Factor 4H
EIF5A pro-674 Recombinant Human Eukaryotic Translation Initiation Factor 5A
EIF5A2 pro-846 Recombinant Human Eukaryotic Translation Initiation Factor 5A2
Eledoisin pro-281 Eledoisin
EMCN pro-1156 Recombinant Human Endomucin
EMG1 pro-1122 Recombinant Human EMG1 Nucleolar Protein
Endostatin pro-248 Recombinant Human Endostatin
Enfuvirtide pro-376 Enfuvirtide T-20
ENSA pro-772 Recombinant Human Endosulfine Alpha
EPCAM pro-1322 Recombinant Human Epithelial Cell Adhesion Molecule
Eptifibatide pro-358 Human Eptifibatide
ER-a pro-499 Recombinant Human Estrogen Receptor Alpha
ERCC1 pro-1106 Recombinant Human Excision Repair Cross-Complementing 1
ERCC1, GST pro-496 Recombinant Human Excision Repair Cross-Complementing 1, GST Tag
ERH pro-121 Recombinant Human Enhancer of Rudimentary
ERLIN2 pro-1266 Recombinant Human ER Lipid Raft Associated 2
ERP27 pro-046 Recombinant Human Endoplasmic Reticulum Protein 27
ERP44 pro-547 Recombinant Human Endoplasmic Reticulum Protein 44
ESAT6 pro-291 Recombinant Early Secretory Target Mycobacterium Tuberculosis
E-Selectin pro-380 Recombinant Human E-Selectin
ESM1 pro-1328 Recombinant Human Endothelial Cell-Specific Molecule 1
ETFB pro-220 Recombinant Human Electron-Transfer-Flavoprotein Beta Polypeptide
ETHE1 pro-1027 Recombinant Human Ethylmalonic Encephalopathy 1
ETS1 pro-501 Recombinant Human C-ets-1 Protein
EXOSC10 pro-444 Recombinant Human Exosome Component 10
EXOSC5 pro-1059 Recombinant Human Exosome Component 5
EXOSC9 pro-126 Recombinant Human Exosome Component 9
EYA2 pro-1071 Recombinant Human Eyes Absent Homolog 2
F11R pro-1112 Recombinant Human F11 Receptor
F3 pro-312 Recombinant Human Coagulation Factor III
F7 pro-331 Recombinant Human Coagulation Factor VIIa
F8 pro-317 Human Coagulation Factor VIII
F8 pro-318 Recombinant Human Coagulation Factor VIII
F9 pro-353 Human Coagulation Factor IX
FABP1 pro-588 Recombinant Human Fatty Acid Binding Protein-1
mFABP1 pro-1121 Recombinant Mouse Fatty Acid Binding Protein-1
FABP12 pro-738 Recombinant Human Fatty Acid Binding Protein-12
FABP2 pro-669 Recombinant Human Fatty Acid Binding Protein-2
FABP3 pro-340 Recombinant Human Fatty Acid Binding Protein-3
FABP3 His pro-668 Recombinant Human Fatty Acid Binding Protein-3, His Tag
FABP4 pro-416 Recombinant Human Fatty Acid Binding Protein-4
FABP4 His pro-566 Recombinant Human Fatty Acid Binding Protein-4, His Tag
FABP5 pro-417 Recombinant Human Fatty Acid Binding Protein-5
FABP5 His pro-666 Recombinant Human Fatty Acid Binding Protein-5, His Tag
FABP6 pro-649 Recombinant Human Fatty Acid Binding Protein-6
FABP6 His pro-667 Recombinant Human Fatty Acid Binding Protein-6, His Tag
FABP7 pro-628 Recombinant Human Fatty Acid Binding Protein-7
FABP7 His pro-661 Recombinant Human Fatty Acid Binding Protein-7, His Tag
FABP9 pro-1088 Recombinant Human Fatty Acid Binding Protein-9
FADD pro-733 Recombinant Human Fas-Associated Death Domain
FAM3B pro-139 Recombinant Human Family with Sequence Similarity 3, Member B
FAM3C pro-952 Recombinant Human Family with Sequence Similarity 3, Member C
FAM49B pro-1411 Recombinant Human Family with Sequence Similarity 49, Member B
FCGR1A pro-1228 Recombinant Human CD64
FCGR2A pro-029 Recombinant Human CD32a
FCGR2B pro-1295 Recombinant Human CD32
FCGR3A pro-1150 Recombinant Human CD16a
FDCSP pro-1339 Recombinant Human Follicular Dendritic Cell Secreted Protein
FDX1 pro-713 Recombinant Human Ferredoxin-1
Ferritin pro-564 Human Liver Ferritin
Ferritin Heavy pro-658 Recombinant Human Ferritin Heavy Chain
Ferritin Light pro-650 Recombinant Human Ferritin Light Chain
Fetuin-A pro-418 Human Alpha-2-HS-Glycoprotein
FHIT pro-828 Recombinant Human Fragile Histidine Triad
FHIT, GST pro-297 Recombinant Human Fragile Histidine Triad, GST Tag
Fibronectin pro-448 Human Fibronectin
Filamin pro-521 Filamin
FIMC pro-120 Recombinant E.Coli Chaperone Protein fimC
FIS1 pro-829 Recombinant Human Fission-1
Flagellin pro-1240 Recombinant Flagellin
FOPNL pro-1195 Recombinant Human FGFR1OP N-terminal like
FOS-B pro-505 Recombinant Human FOS-B
Frataxin pro-761 Recombinant Human Frataxin
FRZB pro-1345 Recombinant Human Frizzled-Related Protein
FSCN1 pro-527 Recombinant Human Fascin
FTSJ2 pro-1207 Recombinant Human FtsJ RNA Methyltransferase Homolog 2
FUBP1 pro-1132 Recombinant Human Far Upstream Element Binding Protein
FUR pro-622 Recombinant E.Coli Ferric Uptake Regulator
FXYD5 pro-1366 Recombinant Human FXYD5
Fyn-p59 pro-506 Recombinant Human Fyn-p59
FZD1 pro-816 Recombinant Human Frizzled-1
GABARAP pro-775 Recombinant Human GABA(A) Receptor-Associated Protein
GABARAPL1 pro-048 Recombinant Human GABA(A) Receptor-Associated Protein Like 1
GABARAPL2 pro-079 Recombinant Human GABA(A) Receptor-Associated Protein Like 2
GADD45A pro-783 Recombinant Human Growth Arrest and DNA-Damage-Inducible Alpha
GADD45B pro-563 Recombinant Human Growth Arrest and DNA-Damage-Inducible Beta
GADD45G pro-570 Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma
GADD45GIP1 pro-972 Recombinant Human Growth Arrest and DNA-Damage-Inducible Gamma Interacting Protein 1
GAGA-POZ pro-435 Recombinant Drosophila melanogaster GAGA-POZ
GAP43 pro-1126 Recombinant Human Growth Associated Protein 43
GAS7 pro-680 Recombinant Human Growth Arrest-Specific 7, Isoform b
GCA pro-080 Recombinant Human Grancalcin
GCSAM pro-1282 Recombinant Human Germinal Center-Associated, Signaling and Motility
GCSH pro-973 Recombinant Human Glycine Cleavage System Protein H
GCV syn-001 Ganciclovir
Gelatin pro-481 Recombinant Human Gelatin
GEMIN6 pro-1394 Recombinant Human Gem-Associated Protein 6
GFER pro-1326 Recombinant Human Growth Factor, Augmenter of Liver Regeneration
GFP pro-522 Glial Filament Protein
GINS4 pro-1270 Recombinant Human GINS Complex Subunit 4
GIPC1 pro-855 Recombinant Human GIPC PDZ Domain Member 1
GIPC2 pro-1035 Recombinant Human GIPC PDZ Domain Member 2
GKN1 pro-1206 Recombinant Human Gastrokine 1
GLC8 pro-540 Recombinant Yeast GLC8
Gliadin pro-114 Recombinant Wheat Gliadin
GLIPR2 pro-550 Recombinant Human GLI Pathogenesis-Related 2
GLOD4 pro-894 Recombinant Human Glyoxalase Domain Containing 4
GLTP pro-1313 Recombinant Human Glycolipid Transfer Protein
GMNN pro-579 Recombinant Human Geminin
GNAI1 pro-940 Recombinant Human Guanine Nucleotide Binding Protein Alpha Inhibiting Activity 1
GNAI2 pro-1310 Recombinant Human Guanine Nucleotide Binding Protein-G Alpha Inhibiting Activity Polypeptide 2
GNAI3 pro-1074 Recombinant Human Guanine Nucleotide Binding Protein Alpha Inhibiting Activity 3
GNAZ pro-1225 Recombinant Human Guanine Nucleotide Binding Protein Alpha Z Polypeptide
GNB2L1 pro-1023 Recombinant Human Guanine Nucleotide Binding Protein beta polypeptide 2-like 1
GNLY pro-852 Recombinant Human Granulysin
GOPC pro-793 Recombinant Human Golgi-Associated PDZ and Coiled-Coil Motif Containing
GOSR2 pro-1399 Recombinant Human Golgi SNAP Receptor Complex Member 2
GP2 pro-115 Recombinant Human Glycoprotein-2
GP9 pro-055 Recombinant Human Glycoprotein-9
GPN1 pro-1140 Recombinant Human GPN-loop GTPase 1
GRAP2 pro-081 Recombinant Human GRB2-Related Adaptor Protein 2
GRB2 pro-678 Recombinant Human Growth Factor Receptor-Bound Protein 2
GREM1 pro-1359 Recombinant Human GREM1
GRPEL1 pro-263 Recombinant Human GrpE-Like 1
GTF2B pro-762 Recombinant Human General Transcription Factor IIB
GTF2E2 pro-1107 Recombinant Human General Transcription Factor IIE, Polypeptide 2
GTF2F2 pro-1093 Recombinant Human General Transcription Factor IIF, Polypeptide 2
GULP1 pro-1398 Recombinant Human GULP1
HAND1 pro-1231 Recombinant Human Heart and Neural Crest Derivatives Expressed 1
Haptoglobin pro-567 Recombinant Human Haptoglobin
Haptoglobin pro-558 Human Haptoglobin
HAUS1 pro-1077 Recombinant Human HAUS Augmin-Like Complex, Subunit 1
HAX1 pro-1367 Recombinant Human HCLS1 Associated Protein X-1
HbA1c pro-299 Human Hemoglobin A1c
HBA2 pro-1183 Recombinant Human Hemoglobin, Alpha 2
HBG2 pro-021 Recombinant Human Hemoglobin Gamma G
HBZ pro-803 Recombinant Human Hemoglobin-Zeta
HDL pro-559 Human High Density Lipoprotein
HEBP1 pro-1316 Recombinant Human Heme Binding Protein 1
Hemopexin pro-560 Human Hemopexin
HES7 pro-1306 Recombinant Human Hairy and Enhancer of Split 7
HEXIM1 pro-789 Recombinant Human Hexamethylene Bis-Acetamide Inducible 1
HFE pro-1332 Recombinant Human Hemochromatosis
HIF1A pro-477 Recombinant Human Hypoxia-Inducible Factor-1 Alpha
HIF1A (85 a.a.) pro-258 Recombinant Human Hypoxia-Inducible Factor-1 Alpha (85 a.a.)
HIF1A His pro-415 Recombinant Human Hypoxia-Inducible Factor-1 Alpha His Tag
HIF1AN pro-662 Recombinant Human Hypoxia-Inducible Factor-1 Alpha Inhibitor
HINT1 pro-702 Recombinant Human Histidine Triad Nucleotide Binding Protein 1
Hirudin pro-362 Recombinant Hirudin
HLF pro-904 Recombinant Human Hepatic Leukemia Factor
HMGA1 pro-887 Recombinant Human High Mobility Group AT-Hook 1
HMGB1 pro-581 Recombinant Human High-Mobility Group Box 1
HMGB1 Hi-5 pro-610 Recombinant Human High-Mobility Group Box 1 Hi-5 Insect Cells
HMGB2 pro-888 Recombinant Human High-Mobility Group Box 2
HMGN1 pro-821 Recombinant Human High-Mobility Group Nucleosome Binding Domain 1
HN1L pro-027 Recombinant Human Hematological and Neurological Expressed 1-Like
HNRNPA1 pro-1038 Recombinant Human Heterogeneous Nuclear Ribonucleoprotein A1
HNRNPC pro-177 Recombinant Human Heterogeneous Nuclear Ribonucleoprotein C
Holo Transferrin pro-315 Human Holo Transferrin
HOMER1 pro-695 Recombinant Human Homer Homolog-1
HOMER2 pro-1072 Recombinant Human Homer Homolog-2
HOMER3 pro-1108 Recombinant Human Homer Homolog-3
HOPX pro-1158 Recombinant Human HOP homeobox
HPCAL1 pro-254 Recombinant Human Hippocalcin-Like 1
HPG1 pro-423 Recombinant Human Prostate Specific Gene-1
HRAS pro-822 Recombinant Human V-Ha-ras Harvey Rat Sarcoma Viral Oncogene Homolog
HRSP12 pro-052 Recombinant Human Heat-Responsive Protein 12
HSA pro-354 Human Serum Albumin
HSCB pro-1142 Recombinant Human HscB Iron-Sulfur Cluster Co-Chaperone
HSD17B10 pro-823 Recombinant Human Hydroxysteroid (17-beta) Dehydrogenase 10
HUS1 pro-039 Recombinant Human HUS1 Checkpoint Homolog
ICAM-1 pro-383 Recombinant Human Intercellular Adhesion Molecule-1
ICT1 pro-1303 Recombinant Human Immature Colon Carcinoma Transcript 1
ID2 pro-1383 Recombinant Human Inhibitor of DNA Binding 2
IFT20 pro-1222 Recombinant Human Intraflagellar Transport 20 Homolog
IGLL1 pro-1390 Recombinant Human Immunoglobulin Lambda-Like Polypeptide 1
IGJ pro-1416 Recombinant Human Immunoglobulin J
IMP3 pro-015 Recombinant Human IMP3
IMPAD1 pro-1346 Recombinant Human Inositol Monophosphatase Domain Containing 1
mIgG pro-1087 Recombinant Mouse Immunoglobulin Heavy Chain Constant Region Gamma 2a
mIgG His pro-1086 Recombinant Mouse Immunoglobulin Heavy Chain Constant Region Gamma 2a, His Tag
Intein pro-958 Recombinant Bacillus Circulans Intein
Internalin pro-031 Recombinant Listeria Monocytogenes Internalin
Intrinsic Factor pro-375 Recombinant Human Intrinsic Factor
Involucrin pro-512 Recombinant Human Involucrin
IPP-POZ pro-436 Recombinant Human IPP-POZ
IRGM pro-1302 Recombinant Human Immunity-Related GTPase Family, M
ISCU pro-072 Recombinant Human Iron-sulfur Cluster Scaffold Homolog
ISG15 pro-611 Recombinant Human Interferon Stimulated Gene 15
ITGB1BP3 pro-1177 Recombinant Human Integrin Beta 1 Binding Protein 3
JAM2 pro-1336 Recombinant Human Junctional Adhesion Molecule 2
JAM3 pro-1223 Recombinant Human Junctional Adhesion Molecule 3
JOSD1 pro-1251 Recombinant Human Josephin Domain Containing 1
k9Cystatin-C pro-138 Recombinant Canine Cystatin-C
KAAG1 pro-192 Recombinant Human Kidney Associated Antigen 1
KCNIP3 pro-009 Recombinant Human Kv Channel Interacting Protein 3
KCTD5 pro-1276 Recombinant Human Potassium Channel Tetramerisation Domain Containing 5
KCTD11 pro-1376 Recombinant Human Potassium Channel Tetramerisation Domain Containing 11
KCTD15 pro-1002 Recombinant Human Potassium Channel Tetramerisation Domain Containing 15
KIN pro-1275 Recombinant Human KIN
KIR2DL1 pro-428 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 1
KIR2DL3 pro-429 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Long Cytoplasmic Tail 3
KIR2DS4 pro-430 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 2 Domains Short Cytoplasmic Tail 4
KIR3DL1 pro-427 Recombinant Human Killer Cell Immunoglobulin-Like Receptor, 3 Domains Long Cytoplasmic Tail 1
KISS1 pro-419 Recombinant Human KISS-1 Metastasis-Suppressor
KLF4 pro-891 Recombinant Human Kruppel-Like Factor 4
KLRB1 pro-1189 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily B, Member 1
KLRC2 pro-1190 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 2
KLRC3 pro-1230 Recombinant Human Killer Cell Lectin-Like Receptor Subfamily C, Member 3
KLRG1 pro-1344 Recombinant Human Killer Cell lectin-like Receptor Subfamily G, Member 1
KLRK1 pro-1290 Recombinant Human Killer Cell lectin-Like Receptor Subfamily K, Member 1
KPNA2 pro-1032 Recombinant Human karyopherin Alpha 2
KPNB1 pro-1001 Recombinant Human karyopherin Beta 1
KRAS pro-854 Recombinant Human Kirsten Rat Sarcoma Viral Oncogene
KRT14 pro-348 Recombinant Human Cytokeratin 14
KRT14 His pro-941 Recombinant Human Cytokeratin 14 His Tag
KRT18 pro-349 Recombinant Human Cytokeratin 18
KRT18 His pro-484 Recombinant Human Cytokeratin 18 His Tag
KRT19 pro-350 Recombinant Human Cytokeratin 19
KRT19 His pro-1347 Recombinant Human Cytokeratin 19 His Tag
KRT20 pro-351 Recombinant Human Cytokeratin 20
KRT20 His pro-1358 Recombinant Human Cytokeratin 20 His Tag
KRT8 pro-347 Recombinant Human Cytokeratin 8
KRT8 GST pro-298 Recombinant Human Cytokeratin 8 GST-Tag
Ku P70/P80 pro-397 Recombinant Human Ku P70/P80
LA/SS-B pro-327 Recombinant Human LA / SS-B
LAIR1 pro-431 Recombinant Human Leukocyte-Associated Ig-Like Receptor 1
LAIR2 pro-1081 Recombinant Human Leukocyte-Associated Ig-Like Receptor 2
Lamin-A pro-690 Recombinant Human Lamin-A
LAMP2 pro-130 Recombinant Human Lysosomal-Associated Membrane Protein 2
LASP1 pro-1031 Recombinant Human LIM and SH3 Protein 1
LAT pro-948 Recombinant Human Linker for Activation of T Cells
LBP pro-538 Recombinant Human Lipopolysaccarid Binding Protein
mLBP pro-539 Recombinant Mouse Lipopolysaccarid Binding Protein
LDL pro-562 Low Density Lipoprotein
LDLRAP1 pro-1033 Recombinant Human Low Density Lipoprotein Receptor Adaptor Protein 1
LDOC1L pro-1153 Recombinant Human Leucine Zipper, Down-Regulated in Cancer 1-Like
LEFTY1 pro-962 Recombinant Human Left-Right Determination Factor 1
LGALS10 pro-744 Recombinant Human Charcot-Leyden Crystal Protein
LGALSL pro-1374 Recombinant Human Lectin Galactoside-Binding-Like
LIN28A pro-743 Recombinant Human LIN28
LIN28B pro-1249 Recombinant Human LIN28B
LIN7A pro-1252 Recombinant Human LIN7A
LIN7B pro-1298 Recombinant Human LIN7B
LIN7C pro-1305 Recombinant Human LIN7C
LITAF pro-1350 Recombinant Human Lipopolysaccharide-Induced TNF Factor
LLC pro-561 Human Lambda Light Chain
LLO pro-320 Recombinant Listeriolysin-O
LLO-pest pro-373 Recombinant Listeriolysin-O PEST-free
LRG1 pro-141 Human Leucine-Rich Alpha-2-Glycoprotein 1
LRPAP1 pro-1029 pro-151
L-Selectin pro-381 Recombinant Human L-Selectin
LSM1 pro-259 Recombinant Human LSM1 Homolog, U6 Small Nuclear RNA Associated
LSM12 pro-1329 Recombinant Human LSM12 Homolog, U6 Small Nuclear RNA Associated
LSM2 pro-1069 Recombinant Human LSM2 Homolog, U6 Small Nuclear RNA Associated
LSM3 pro-1060 Recombinant Human LSM3 Homolog, U6 Small Nuclear RNA Associated
LSM4 pro-065 Recombinant Human LSM4 Homolog, U6 Small Nuclear RNA Associated
LTF Holo pro-592 Recombinant Human Lactoferrin Holo
LYG2 pro-1245 Recombinant Human Lysozyme G-Like 2
LYN pro-136 Recombinant Human v-yes-1 Yamaguchi Sarcoma Viral Related Oncogene
M.Pneumoniae pro-795 Recombinant Mycoplasma Pneumoniae P1-N2
M.Pneumoniae pro-801 Recombinant Mycoplasma Pneumoniae P1-C
MAD2L1 pro-934 Recombinant Human MAD2 Mitotic Arrest Deficient-Like 1
MAD2L1BP pro-1052 Recombinant Human MAD2L1 Binding Protein
MAF1 pro-921 Recombinant Human MAF1
MAFG pro-968 Recombinant Human V-maf Musculoaponeurotic Fibrosarcoma Oncogene G
MAFK pro-025 Recombinant Human V-maf Musculoaponeurotic Fibrosarcoma Oncogene K
MAGEA1 pro-311 Recombinant Human Melanoma Antigen Family A, 1
MAGEA3 pro-502 Recombinant Human Melanoma Antigen Family A, 3
MAGEA4 pro-843 Recombinant Human Melanoma Antigen Family A, 4
MAGEA5 pro-1070 Recombinant Human Melanoma Antigen Family A, 5
MAGEA6 pro-1113 Recombinant Human Melanoma Antigen Family A, 6
MAGOH pro-810 Recombinant Human Mago-Nashi Homolog
MAP1LC3A pro-495 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Alpha
MAP1LC3B pro-076 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Beta
MAP1LC3B2 pro-215 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 Beta 2
MAPKSP1 pro-034 Recombinant Human MAPK Scaffold Protein 1
MAPRE1 pro-058 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 1
MAPRE2 pro-932 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 2
MAPRE3 pro-264 Recombinant Human Microtubule-Associated Protein, RP/EB Family, Member 3
MAPT pro-295 Recombinant Human Microtubule-Associated Protein Tau
MAPT 381a.a. pro-042 Recombinant Human Microtubule-Associated Protein Tau 381 a.a.
MAPT 383a.a. pro-012 Recombinant Human Microtubule-Associated Protein Tau 383 a.a.
MAPT 412a.a. pro-210 Recombinant Human Microtubule-Associated Protein Tau 412 a.a.
MAVS pro-1351 Recombinant Human Mitochondrial Antiviral Signaling Protein
MAX pro-811 Recombinant Human MYC Associated Factor X
MBD3 pro-1243 Recombinant Human Methyl-CpG Binding Domain Protein 3
MBL2 pro-1285 Recombinant Human Mannose-Binding Lectin 2
MBP pro-616 Recombinant E.Coli Maltose Binding Protein
MCFD2 pro-769 Recombinant Human Multiple Coagulation Factor Deficiency 2
MCL1 pro-1202 Recombinant Human Myeloid Cell Leukemia Sequence 1
MCTS1 pro-1387 Recombinant Human Malignant T-Cell-Amplified Sequence 1
MECP2 pro-212 Recombinant Human Methyl CpG Binding Protein 2
MED20 pro-1204 Recombinant Human Mediator Complex Subunit 20
MED4 pro-785 Recombinant Human Mediator Complex Subunit 4
MED7 pro-1319 Recombinant Human Mediator Complex Subunit 7
Melanoma pro-509 Recombinant Human Melanoma (gp100)
MEMO1 pro-1148 Recombinant Human Mediator of Cell Motility 1
MESDC2 pro-122 Recombinant Human Mesoderm Development Candidate 2
MET pro-207 Recombinant Human Met Proto-Oncogene
MET, GST pro-497 Recombinant Human Met Proto-Oncogene, GST Tag
MFAP2 pro-1265 Recombinant Human Microfibrillar-associated Protein 2
MFAP4 pro-1210 Recombinant Human Microfibrillar-associated Protein 4
MGP pro-922 Recombinant Human Matrix Gla Protein
MICA pro-367 Recombinant Human MHC class I chain-related gene A
MICB pro-368 Recombinant Human MHC class I chain-related gene B
MIS12 pro-022 Recombinant Human MIS12
MLF1 pro-100 Recombinant Human Myeloid Leukemia Factor 1
MMACHC pro-1119 Recombinant Human Methylmalonic Aciduria cblC type, with Homocystinuria
MNDA pro-763 Recombinant Human Myeloid Cell Nuclear Differentiation Antigen
MOBKL1B pro-068 Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 1B
MOBLK3 pro-049 Recombinant Human MOB1, Mps One Binder Kinase Activator-Like 3
MOCS2 pro-1281 Recombinant Human Molybdenum Cofactor Synthesis 2
MOG pro-371 Myelin Oligodendrocyte Glycoprotein
MOG pro-466 Recombinant Human Myelin Oligodendrocyte Glycoprotein
MORF4L1 pro-1078 Recombinant Human Mortality Factor 4 Like 1
MORF4L2 pro-475 Recombinant Human Mortality Factor 4 Like 2
MRAS pro-1008 Recombinant Human Muscle RAS Oncogene Homolog
MRM1 pro-1416 Recombinant Human Mitochondrial RRNA Methyltransferase 1
MRRF pro-1299 Recombinant Human Mitochondrial Ribosome Recycling Factor
MRTO4 pro-1233 Recombinant Human mRNA Turnover 4
MRPL28 pro-1279 Recombinant Human Mitochondrial Ribosomal Protein L28
MRPL13 pro-1404 Recombinant Human Mitochondrial Ribosomal Protein L13
MSH6 pro-745 Recombinant Human MutS Homolog 6
MXD3 pro-1356 Recombinant Human MAX Dimerization Protein 3
MUTED pro-1155 Recombinant Human MUTED
MYC pro-087 Recombinant Human V-Myc Myelocytomatosis Viral Oncogene
MYCBP pro-942 Recombinant Human C-Myc Binding Protein
MYD88 pro-1377 Recombinant Human Myeloid Differentiation Primary Response 88
MYL1 pro-365 Recombinant Human Myosin Light Chain 1
MYL12A pro-902 Recombinant Human Myosin Light Chain 12A
MYL12B pro-1124 Recombinant Human Myosin Light Chain 12B
MYL2 pro-524 Recombinant Human Myosin Light Chain 2
MYL4 pro-992 Recombinant Human Myosin Light Chain 4
MYL5 pro-916 Recombinant Human Myosin Light Chain 5
MYL5 (1-173 a.a.) pro-943 Recombinant Human Myosin Light Chain 5 (1-173 a.a.)
MYL6 pro-171 Recombinant Human Myosin Light Chain 6
MYL6B pro-964 Recombinant Human Myosin Light Chain 6B
MYL7 pro-1109 Recombinant Human Myosin Light Chain 7
MYL9 pro-107 Recombinant Human Myosin Light Chain 9
MYLPF pro-243 Recombinant Human Myosin Light chain, Phosphorylatable, Fast Skeletal Muscle
Myoglobin pro-336 Recombinant Human Myoglobin
Myoglobin pro-565 Human Myoglobin
Myoglobin heme free pro-374 Recombinant Human Myoglobin Heme free
Myoglobin His pro-071 Recombinant Human Myoglobin, His Tag
NACA pro-974 Recombinant Human Nascent Polypeptide-Associated Complex Alpha
NANOG pro-896 Recombinant Human Nanog
NANOG, His pro-881 Recombinant Human Nanog, His Tag
NANOG-TAT pro-090 Recombinant Human Nanog-TAT
NAP1L1 pro-985 Recombinant Human Nucleosome Assembly Protein 1-Like 1
NAPA pro-250 Recombinant Human N-Ethylmaleimide-Sensitive Factor Attachment Protein, Alpha
NAPG pro-944 Rcombinant Human N-ethylmaleimide-Sensitive Factor Attachment Protein, Gamma
NBL1 pro-1365 Recombinant Human Neuroblastoma 1
NCALD pro-093 Recombinant Human Neurocalcin Delta
NCBP2 pro-265 Recombinant Human Nuclear Cap Binding Protein Subunit 2
NCEH1 pro-1393 Recombinant Human Neutral Cholesterol Ester Hydrolase 1
NCF1 pro-488 Recombinant Human Neutrophil Cytosolic Factor 1
NCF4 pro-1258 Recombinant Human Neutrophil Cytosolic Factor 4
NCK1 pro-839 Recombinant Human NCK Adaptor Protein 1
NCS1 pro-802 Recombinant Human Neuronal Calcium Sensor 1
NDE1 pro-204 Recombinant Human nudE Nuclear Distribution Gene E Homolog 1
NDRG1 pro-724 Recombinant Human N-Myc Downstream Regulated 1
NDRG2 pro-1198 Recombinant Human N-Myc Downstream Regulated 2
NECAP2 pro-180 Recombinant Human NECAP Endocytosis Associated 2
NFKBIA pro-960 Recombinant Human NF-kappa-B Inhibitor Alpha
NFKBIB pro-1046 Recombinant Human NF-kappa-B Inhibitor Beta
NHEJ1 pro-1193 Recombinant Human Nonhomologous End-Joining Factor 1
NHP2 pro-067 Recombinant Human NHP2 Ribonucleoprotein Homolog
NHP2L1 pro-038 Recombinant Human NHP2 Non-Histone Chromosome Protein 2-Like
NIP7 pro-780 Recombinant Human Nuclear Import 7 Homolog
NKIRAS1 pro-1039 Recombinant Human NFKB Inhibitor Interacting Ras-Like 1
NKIRAS2 pro-1091 Recombinant Human NFKB Inhibitor Interacting Ras-Like 2
NKp46 pro-432 Recombinant Human Natural Cytotoxicity Receptor NKp46
NKX3-1 pro-1341 Recombinant Human NK3 Homeobox 1
NME1 pro-715 Recombinant Human Non-Metastatic Cells 1
NME3 pro-082 Recombinant Human Non-Metastatic Cells 3
NME4 pro-219 Recombinant Human Non-Metastatic Cells 4
NMI pro-070 Recombinant Human N-Myc Interactor
NMM pro-366 Recombinant Human Non-Muscle Myosin-II Regulatory Light Chain
NMRAL1 pro-1131 Recombinant Human NmrA-Like Family Domain Containing 1
NOL3 pro-1178 Recombinant Human Nucleolar Protein 3
6 pro-1340 Recombinant Human 6
NPM1 pro-1120 Recombinant Human Nucleophosmin
NPM2 pro-1182 Recombinant Human Nucleophosmin 2
NR1H2 pro-869 Recombinant Human Nuclear Receptor Subfamily 1 Group H, Member 2
NRAS pro-794 Recombinant Human Neuroblastoma RAS Viral Oncogene Homolog
NRIP3 pro-1384 Recombinant Human Nuclear Receptor-Interacting Protein 3
NTAL pro-827 Recombinant Human Non-T-cell Activation Linker
NTS pro-1311 Recombinant Human Neurotensin
NUCB2 pro-492 Recombinant Human Nucleobindin-2
NUCB2, His pro-142 Recombinant Human Nucleobindin-2, His Tag
mNUCB2 pro-605 Recombinant Mouse Nucleobindin-2
NUP210 pro-109 Recombinant Human Nucleopurin 210kDa
NUP62 pro-999 Recombinant Human Nucleopurin 62kDa
NusA pro-623 Recombinant E.Coli Transcription Termination/Antitermination L Factor
NUTF2 pro-844 Recombinant Human Nuclear Transport Factor 2
NXT1 pro-218 Recombinant Human NTF2-like Export Factor 1
NXT2 pro-1051 Recombinant Human NTF2-like Export Factor 2
NY-ESO-1 pro-531 Recombinant Human New York Esophageal Squamous Cell Carcinoma
OAZ1 pro-1200 Recombinant Human Ornithine Decarboxylase Antizyme 1
OBFC1 pro-028 Recombinant Human Oligonucleotide Binding Fold Containing 1
OCM pro-143 Recombinant Human Oncomodulin-1
OLR1 pro-923 Recombinant Human Oxidized Low Density Lipoprotein Receptor 1
OMP pro-1412 Recombinant Human Olfactory Marker Protein
Omp Pylori pro-369 Recombinant Helicobacter Pylori Outer Membrane Protein
OmpA pro-571 Recombinant Bacterial Outer Membrane Protein-A
ORAOV1 pro-1092 Recombinant Human Oral Cancer Overexpressed 1
ORM1 pro-889 Recombinant Human Orosomucoid 1
Osteocrin pro-420 Recombinant Human Osteocrin
OTUB1 pro-711 Recombinant Human Ubiquitin Aldehyde Binding 1
OTUB2 pro-214 Recombinant Human Ubiquitin Aldehyde Binding 2
OVCA2 pro-1123 Recombinant Human Ovarian Tumor Suppressor Candidate 2
p53 pro-742 Recombinant Human p53
p53 Mutant pro-301 Recombinant Human p53 Mutant
PA2G4 pro-782 Recombinant Human Proliferation-associated protein 2G4
PAEP pro-1397 Recombinant Human Progesterone-Associated Endometrial Protein
PAIP2 pro-748 Recombinant Human Polyadenylate-Binding Protein-Interacting Protein 2
PARD6B pro-1307 Recombinant Human Par-6 Partitioning Defective 6 Homolog Beta
PARK7 pro-575 Recombinant Human Parkinson Disease Protein 7
PARVA pro-1257 Recombinant Human Parvin Alpha
PBLD pro-010 Recombinant Human Phenazine Biosynthesis-Like Protein Domain Containing
pCD163 pro-856 Recombinant Porcine CD163
PCNA pro-615 Recombinant Human Proliferating Cell Antigen
PCNA GST pro-741 Recombinant Human Proliferating Cell Antigen, GST Tag
PCNA Sf9 pro-303 Recombinant Human Proliferating Cell Antigen, S9
PCNP pro-906 Recombinant Human PEST proteolytic Signal Containing Nuclear Protein
PDAP1 pro-490 Recombinant Human PDGFA Associated Protein 1
PDCD4 pro-606 Recombinant Human ProgrammedCell Death 4
PDCD5 pro-624 Recombinant Human Programmed Cell Death 5
PDCD6 pro-184 Recombinant Human Programmed Cell Death 6
PDCD6IP pro-792 Recombinant Human ProgrammedCell Death 6 Interacting Protein
PDCL pro-1141 Recombinant Human Phosducin-Like
PDCL3 pro-1028 Recombinant Human Phosducin-Like 3
PDPN pro-626 Recombinant Human Podoplanin
PDRG1 pro-007 Recombinant Human p53 and DNA-Damage Regulated 1
PDZD11 pro-1263 Recombinant Human PDZ Domain Containing 11
PEA15 pro-729 Recombinant Human Phosphoprotein Enriched in Astrocytes 15
PEBP1 pro-722 Recombinant Human Phosphatidylethanolamine Binding Protein 1
PEF1 pro-099 Recombinant Human Penta-EF-Hand Domain Containing 1
PEX pro-360 Recombinant Human C-terminal hemopexin-like domain of MMP-2 (445-635 a.a.)
PEX19 pro-925 Recombinant Human Peroxisomal Biogenesis Factor 19
PFDN1 pro-277 Recombinant Human Prefoldin Subunit 1
PFDN2 pro-001 Recombinant Human Prefoldin Subunit 2
PFDN4 pro-092 Recombinant Human Prefoldin Subunit 4
PFDN5 pro-901 Recombinant Human Prefoldin Subunit 5
PFDN6 pro-178 Recombinant Human Prefoldin Subunit 6
PFN1 pro-528 Recombinant Human Profilin-1
PFN2 pro-809 Recombinant Human Profilin-2
PFN4 pro-818 Recombinant Human Profilin-4
PGP9.5 pro-576 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase L1
PGP9.5 GST pro-304 Recombinant Human Ubiquitin Carboxyl-Terminal Hydrolase L1 GST tag
PGR pro-535 Recombinant Human Progesterone Receptor
PHB pro-1381 Recombinant Human Prohibitin
PHF11 pro-1268 Recombinant Human PHD Finger Protein 11
PHLDA2 pro-781 Recombinant Human Pleckstrin Homology-Like Domain Family A Member 2
PIM1 pro-1389 Recombinant Human PIM1
PINX1 pro-693 Recombinant Human PIN2-Interacting Protein 1
PIR pro-1040 Recombinant Human Pirin
PITPNA pro-044 Recombinant Human Phosphatidylinositol Transfer Protein, Alpha
PITPNB pro-003 Recombinant Human Phosphatidylinositol Transfer Protein, Beta
PLDN pro-1068 Recombinant Human Pallidin Homolog
PLSCR1 pro-1271 Recombinant Human Phospholipid Scramblase 1
PMP2 pro-651 Recombinant Human Peripheral Myelin Protein-2
PMP2 His pro-671 Recombinant Human Peripheral Myelin Protein-2, His Tag
POLR2J pro-1260 Recombinant Human Polymerase (RNA) III (DNA directed) Polypeptide J
POLR3H pro-1250 Recombinant Human Polymerase (RNA) III (DNA directed) Polypeptide H
POMC pro-236 Recombinant Human Proopiomelanocortin
POP4 pro-1407 Recombinant Human Processing Of Precursor 4
POU2AF1 pro-880 Recombinant Human POU class 2 associating factor 1
POU5F1 pro-088 Recombinant Human POU Class 5 Homeobox 1
POU5F1 PolyR pro-091 Recombinant Human POU Class 5 Homeobox 1 Polyarginine-Tag
PQBP1 pro-1101 Recombinant Human Polyglutamine Binding Protein 1
Prealbumin pro-771 Recombinant Human Transthyretin
Prelamin-A pro-689 Recombinant Prelamin-A
PRND pro-018 Recombinant Human Prion Protein 2
PRNP pro-1400 Recombinant Human Prion Protein
PROC pro-485 Recombinant Human Protein-c
Protein-A/G pro-646 Recombinant Protein A/G
Protein-G pro-402 Recombinant Protein G
Protein-G His pro-1237 Recombinant Protein G His Tag
Prothrombin pro-439 Human Prothrombin Complex
P-Selectin pro-382 Recombinant Human P-Selectin
PSMA pro-740 Recombinant Human Prostate Specific Membrane Antigen
PSMB10 pro-931 Recombinant Human Proteasome Beta Type 10
PSME1 pro-266 Recombinant Human Proteasome Activator Subunit 1
PSME2 pro-975 Recombinant Human Proteasome Activator Subunit 2
PSME3 pro-987 Recombinant Human Proteasome Activator Subunit 3
PSMG2 pro-930 Recombinant Human Proteasome Assembly Chaperone 2
PSMG3 pro-261 Recombinant Human Proteasome Assembly Chaperone 3
PSMG4 pro-989 Recombinant Human Proteasome Assembly Chaperone 4
PSP94 pro-598 Recombinant Human Beta-Microseminoprotein
PTEN pro-305 Recombinant Human Phosphatase and Tensin Homolog
PTEN His pro-712 Recombinant Human Phosphatase and Tensin homolog His Tag
PTGDS pro-316 Recombinant Human Beta-Trace
pThrombin pro-617 Porcine Thrombin
pTrypsin pro-787 Recombinant Porcine Trypsin
PTTG1 pro-717 Recombinant Human Pituitary Tumor-Transforming Protein 1
PTX3 pro-694 Recombinant Human Pentraxin-3
PVALB pro-004 Recombinant Human Parvalbumin
RAB10 pro-1361 Recombinant Human RAB10, Member RAS Oncogene Family
RAB11A pro-826 Recombinant Human RAB11A, Member RAS Oncogene Family
RAB13 pro-882 Recombinant Human RAB13, Member RAS Oncogene Family
RAB14 pro-873 Recombinant Human RAB14, Member RAS Oncogene Family
RAB17 pro-874 Recombinant Human RAB17, Member RAS Oncogene Family
RAB18 pro-976 Recombinant Human RAB18, Member RAS Oncogene Family
RAB1A pro-097 Recombinant Human RAB1A, Member RAS Oncogene Family
RAB1B pro-045 Recombinant Human RAB1B, Member RAS Oncogene Family
RAB21 pro-101 Recombinant Human RAB21, Member RAS Oncogene Family
RAB22A pro-929 Recombinant Human RAB22, Member RAS Oncogene Family
RAB23 pro-977 Recombinant Human RAB23, Member RAS Oncogene Family
RAB24 pro-951 Recombinant Human RAB24, Member RAS Oncogene Family
RAB27A pro-825 Recombinant Human RAB27A, Member RAS Oncogene Family
RAB27B pro-075 Recombinant Human RAB27B, Member RAS Oncogene Family
RAB2A pro-244 Recombinant Human RAB2A, Member RAS Oncogene Family
RAB2B pro-1013 Recombinant Human RAB2B, Member RAS Oncogene Family
RAB31 pro-1090 Recombinant Human RAB31, Member RAS Oncogene Family
RAB32 pro-950 Recombinant Human RAB32, Member RAS Oncogene Family
RAB34 pro-978 Recombinant Human RAB34, Member RAS Oncogene Family
RAB35 pro-935 Recombinant Human RAB35, Member RAS Oncogene Family
RAB3A pro-870 Recombinant Human RAB3A, Member RAS Oncogene Family
RAB3B pro-875 Recombinant Human RAB3B, Member RAS Oncogene Family
RAB3D pro-247 Recombinant Human RAB3D, Member RAS Oncogene Family
RAB4A pro-871 Recombinant Human RAB4A, Member RAS Oncogene Family
RAB5A pro-590 Recombinant Human RAB5A, Member RAS Oncogene Family
RAB5B pro-056 Recombinant Human RAB5B, Member RAS Oncogene Family
RAB6A pro-047 Recombinant Human RAB6A, Member RAS Oncogene Family
RAB6B pro-103 Recombinant Human RAB6B, Member RAS Oncogene Family
RAB7A pro-077 Recombinant Human RAB7A, Member RAS Oncogene Family
RABIF pro-300 Recombinant Human RAB Interacting Factor
RAC1 pro-572 Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1
RAC1 His pro-731 Recombinant Human Ras-Related C3 Botulinum Toxin substrate 1 His Tag
RAC2 pro-619 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 2
RAC2 (189) pro-719 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 2 (1-189)
RAC3 pro-073 Recombinant Human Ras-Related C3 Botulinum Toxin Substrate 3
RAD1 pro-868 Recombinant Human RAD1
RAET1E pro-1293 Recombinant Human Retinoic Acid Early Transcript 1E
RALA pro-043 Recombinant Human V-ral Simian Leukemia Viral Oncogene Homolog A
RALB pro-053 Recombinant Human V-ral Simian Leukemia Viral Oncogene Homolog B
RAMP3 pro-1367 Recombinant Human Receptor Activity-Modifying Protein 3
RAN pro-841 Recombinant Human RAN, Member RAS Oncogene Family
RANBP1 pro-1064 Recombinant Human RAN Binding Protein 1
RANGRF pro-1149 Recombinant Human RAN Guanine Nucleotide Release Factor
RAP1A pro-848 Recombinant Human RAP1A, Member RAS Oncogene Family
RAP1B pro-083 Recombinant Human RAP1B, Member RAS Oncogene Family
RAP2B pro-1364 Recombinant Human RAP2B, Member RAS Oncogene Family
RAP2A pro-061 Recombinant Human RAP2A, Member RAS Oncogene Family
RARA pro-596 Recombinant Retnoid Acid Receptor Alpha
RARRES2 pro-788 Recombinant Human Retinoic Acid Receptor Responder 2
RASSF1A pro-1288 Recombinant Human Ras association domain-containing protein 1
RASSF3 pro-1378 Recombinant Human Ras Association Domain-Containing Protein 3
RB1 pro-584 Recombinant Human Retinoblastoma Associated Protein
RBBP4 pro-1168 Recombinant Human Retinoblastoma Binding Protein 4
RBBP9 pro-991 Recombinant Human Retinoblastoma Binding Protein 9
RBM8A pro-186 Recombinant Human RNA Binding Motif Protein 8A
rCALB1 pro-400 Recombinant Rat Calbindin-1
RCAN1 pro-319 Recombinant Human Regulator of Calcineurin 1
RCAN2 pro-990 Recombinant Human Regulator of Calcineurin 2
RCAN3 pro-1284 Recombinant Human Regulator of Calcineurin 3
RCN1 pro-544 Recombinant Human Reticulocalbin 1
RCN2 pro-189 Recombinant Human Reticulocalbin 2
RCN3 pro-1049 Recombinant Human Reticulocalbin 3
RCVRN pro-441 Recombinant Human Recoverin
RDBP pro-181 Recombinant Human RD RNA Binding Protein
REG1A pro-289 Recombinant Human Regenerating Islet-Derived 1 Alpha
REG1B pro-391 Recombinant Human Regenerating Islet-Derived 1 Beta
REG3A pro-421 Recombinant Human Regenerating Islet-Derived 3 Alpha
REG4 pro-424 Recombinant Human Regenerating Islet-Derived 4
RERG pro-106 Recombinant Human RAS-like, Estrogen-Regulated, Growth Inhibitor
rFibronectin pro-131 Rat Fibronectin
rGFP pro-687 Recombinant Green Fluorescent Protein
RGN pro-915 Recombinant Human Regucalcin
RGS1 pro-1118 Recombinant Human Regulator of G-Protein Signaling 1
RGS10 pro-890 Recombinant Human Regulator of G-Protein Signaling 10
RGS14 pro-1151 Recombinant Human Regulator of G-Protein Signaling 14
RGS16 pro-798 Recombinant Human Regulator of G-Protein Signaling 16
RGS17 pro-924 Recombinant Human Regulator of G-Protein Signaling 17
RGS19 pro-037 Recombinant Human Regulator of G-Protein Signaling 19
RGS2 pro-182 Recombinant Human Regulator of G-Protein Signaling 2
RGS21 pro-898 Recombinant Human Regulator of G-Protein Signaling 21
RGS4 pro-900 Recombinant Human Regulator of G-Protein Signaling 4
RGS5 pro-905 Recombinant Human Regulator of G-Protein Signaling 5
RHEB pro-308 Recombinant Human Ras Homolog Enriched in Brain
RHOA pro-057 Recombinant Human Ras Homolog Gene Family Member A
RHOB pro-224 Recombinant Human Ras Homolog Gene Family Member B
RHOC pro-865 Recombinant Human Ras Homolog Gene Family Member C
RHOD pro-190 Recombinant Human Ras Homolog Gene Family Member D
RHOG pro-1136 Recombinant Human Ras Homolog Gene Family Member G
RHOV pro-1199 Recombinant Human Ras Homolog Gene Family Member V
rHSA HEK pro-967 Recombinant Human Serum Albumin, HEK
rHSA Plant pro-595 Recombinant Human Serum Albumin, Plant
RLN2 pro-1327 Recombinant Human Relaxin-2
rmS100b pro-1236 Recombinant Rhesus Macaque S100 Calcium Binding Protein B
RND1 pro-893 Recombinant Human Rho Family GTPase 1
RND3 pro-487 Recombinant Human Rho Family GTPase 3
RNF181 pro-1218 Recombinant Human Ring Finger Protein 181
RNF4 pro-1255 Recombinant Human Ring Finger Protein 4
ROBLD3 pro-050 Recombinant Human Roadblock Domain Containing 3
RORC pro-206 Recombinant Human RAR-Related Orphan Receptor C
RP9 pro-1314 Recombinant Human Retinitis Pigmentosa 9
RPA2 pro-011 Recombinant Human Replication Protein A2
RPL26L1 pro-1242 Recombinant Human Ribosomal Protein L26-Like 1
RPL8 pro-1053 Recombinant Human Ribosomal Protein L8
RPLP0 pro-392 Recombinant Human Ribosomal Phosphoprotein P0
RPLP1 pro-127 Recombinant Human Ribosomal Phosphoprotein P1
RPLP2 pro-128 Recombinant Human Ribosomal Phosphoprotein P2
RPS3 pro-954 Recombinant Human Ribosomal Protein S3
RPS3A pro-1125 Recombinant Human Ribosomal Protein S3A
RPS5 pro-1300 Recombinant Human Ribosomal Protein S5
RPS7 pro-993 Recombinant Human Ribosomal Protein S7
RPS10 pro-1409 Recombinant Human Ribosomal Protein S10
RPS14 pro-118 Recombinant Human Ribosomal Protein S14
rPVALB pro-398 Recombinant Rat Parvalbumin
RQCD1 pro-008 Recombinant Human RCD1 Required for Cell Differentiation1
RRAGC pro-1050 Recombinant Human Ras-Related GTP Binding C
rRAP pro-352 Recombinant Rat Receptor Associated Protein
RRAS pro-808 Recombinant Human Related RAS Viral (r-ras) Oncogene Homolog
RRAS2 pro-728 Recombinant Human Related RAS Viral (r-ras) Oncogene Homolog 2
rSCGN pro-657 Recombinant Rat Secretagogin
RSG1 pro-1334 Recombinant Human REM2 and RAB-Like Small GTPase 1
RTN4IP1 pro-1014 Recombinant Human Reticulon 4 Interacting Protein 1
rTpc1808 pro-587 Recombinant Rat Tropic 1808
rTroponin-C pro-323 Rabbit Skeletal Muscle Troponin-C
RUNX3 pro-836 Recombinant Human Runt-Related Transcription Factor 3
RUVBL1 pro-861 Recombinant Human RuvB-Like 1
rVCAM1 pro-361 Recombinant Rabbit Vascular cell adhesion molecule 1
RWDD1 pro-1309 Recombinant Human RWD Domain Containing 1
RXRA pro-437 Recombinant Human Retinoid X Receptor Alpha
RYBP pro-1139 Recombinant Human RING1 & YY1 Binding Protein
S100A1 pro-364 Recombinant Human S100 Calcium Binding Protein A1
mS100A1 pro-237 Recombinant Mouse S100 Calcium Binding Protein A1
S100A10 pro-384 Recombinant Human S100 Calcium Binding Protein A10
S100A11 pro-385 Recombinant Human S100 Calcium Binding Protein A11
S100A12 pro-152 Recombinant Human S100 Calcium Binding Protein A12
S100A13 pro-153 Recombinant Human S100 Calcium Binding Protein A13
S100A14 pro-154 Recombinant Human S100 Calcium Binding Protein A14
S100A16 pro-155 Recombinant Human S100 Calcium Binding Protein A16
S100A2 pro-146 Recombinant Human S100 Calcium Binding Protein A2
S100A3 pro-755 Recombinant Human S100 Calcium Binding Protein A3
mS100A3 pro-1166 Recombinant Mouse S100 Calcium Binding Protein A3
S100A4 pro-307 Recombinant Human S100 Calcium Binding Protein A4
S100A4 His pro-698 Recombinant Human S100 Calcium Binding Protein A4 His Tag
mS100A4 pro-229 Recombinant Mouse S100 Calcium Binding Protein A4
S100A5 pro-147 Recombinant Human S100 Calcium Binding Protein A5
mS100A5 pro-1084 Recombinant Mouse S100 Calcium Binding Protein A5
S100A6 pro-148 Recombinant Human S100 Calcium Binding Protein A6
mS100A6 pro-409 Mouse S100 Calcium Binding Protein A6
mS100A6 pro-240 Recombinant Mouse S100 Calcium Binding Protein A6
S100A7 pro-149 Recombinant Human S100 Calcium Binding Protein A7
S100A7A pro-756 Recombinant Human S100 Calcium Binding Protein A7A
S100A8 pro-800 Recombinant Human S100 Calcium Binding Protein A8
S100A8, His pro-150 Recombinant Human S100 Calcium Binding Protein A8, His Tag
mS100A8 pro-233 Recombinant Mouse S100 Calcium Binding Protein A8
S100A9 pro-814 Recombinant Human S100 Calcium Binding Protein A9
S100A9, His pro-151 Recombinant Human S100 Calcium Binding Protein A9, His Tag
mS100A9 pro-878 Recombinant Mouse S100 Calcium Binding Protein A9
S100b pro-306 Recombinant Human S100 Calcium Binding Protein B
mS100b pro-853 Recombinant Mouse S100 Calcium Binding Protein B
S100b GST pro-737 Recombinant Human S100 Calcium Binding Protein B, GST Tag
S100G pro-399 Recombinant Rat S100 Calcium Binding Protein G
S100G pro-156 Recombinant Human S100 Calcium Binding Protein G
S100P pro-425 Recombinant Human S100 Calcium Binding Protein P
S100P His pro-830 Recombinant Human S100 Calcium Binding Protein P, His Tag
S100Z pro-840 Recombinant HumanS100 Calcium Binding Protein Z
mS100A15 pro-1145 Recombinant Mouse S100 Calcium Binding Protein A15
SAMD13 pro-355 Recombinant Human Sterile Alpha Motif Domain Containing 13
SAP18 pro-707 Recombinant Human Sin3A-Associated Protein, 18kDa
SAR1A pro-709 Recombinant Human GTP-Binding Protein SAR1A
SAR1B pro-310 Recombinant Human GTP-Binding Protein SAR1B
SBDS pro-272 Recombinant Human Shwachman-Bodian-Diamond Syndrome
SCAND1 pro-269 Recombinant Human SCAN domain containing 1
SCG5 pro-467 Recombinant Human Secretogranin V
SCGB2A2 pro-515 Recombinant Human Mammaglobin-A
SCGN pro-599 Recombinant Human Secretagogin
SCO2 pro-054 Recombinant Human SCO Cytochrome Oxidase Deficient Homolog 2
SDC1 pro-1065 Recombinant Human Syndecan-1
SDC1, GST pro-516 Recombinant Human Syndecan-1, GST tag
SDC4 pro-778 Recombinant Human Syndecan-4
SDC4, His pro-583 Recombinant Human Syndecan-4, His Tag
SDCBP pro-036 Recombinant Human Syndecan Binding Protein
SDCBP2 pro-1297 Recombinant Human Syndecan Binding Protein 2
SDHAF2 pro-593 Recombinant Human Succinate Dehydrogenase Complex Assembly Factor 2
SDR16C5 pro-1385 Recombinant Human Short Chain Dehydrogenase/Reductase Family 16C, Member 5
SEC13 pro-194 Recombinant Human SEC13
SEC22B pro-1212 Recombinant Human SEC22 Homolog B
SecB pro-697 Recombinant Protein Export Protein SecB
SEPT2 pro-255 Recombinant Human Septin-2
SEPT5 pro-879 Recombinant Human Septin-5
SEPT6 pro-949 Recombinant Human Septin-6
SEPX1 pro-260 Recombinant Human Selenoprotein X 1
SERPINA1 pro-456 Human Alpha-1 Antitrypsin
SERPINA1 pro-529 Recombinant Human Alpha-1 Antitrypsin
SERPINA1, Active pro-907 Recombinant Human Alpha-1 Antitrypsin, Active
SERPINA3 pro-750 Recombinant Human Alpha-1 AntiChymotrypsin
SERPINA3 pro-378 Human Alpha-1 AntiChymotrypsin
SERPINA5 pro-749 Recombinant Human Serpin Peptidase Inhibitor, Clade A Member 5
SERPINB5 pro-202 Recombinant Human Serpin Peptidase Inhibitor, Clade B Member 5
SERPINB5 His pro-704 Recombinant Human Serpin Peptidase Inhibitor, Clade B Member 5, His Tag
SERPING1 pro-1401 Recombinant Human Serpin Peptidase Inhibitor, Clade G Member 1
SERPINI1 pro-213 Recombinant Human Serpin Peptidase Inhibitor, Clade I Member 1
SERTAD1 pro-1157 Recombinant Human SERTA Domain Containing 1
SF3B14 pro-105 Recombinant Human Splicing Factor 3B, 14 kDa Subunit
SGCD pro-1373 Recombinant Human Sarcoglycan Delta
SGTA pro-807 Recombinant Human Small Glutamine-Rich Tetratricopeptide Repeat-Containing Protein Alpha
SH2D1A pro-006 Recombinant Human SH2 domain containing 1A
SH3BGRL pro-1159 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like
SH3BGRL2 pro-1215 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 2
SH3BGRL3 pro-1216 Recombinant Human SH3 Domain Binding Glutamic Acid-Rich Protein Like 3
SH3GL2 pro-1083 Recombinant Human SH3-domain GRB2-like 2
SH3GLB1 pro-1278 Recombinant Human SH3-domain GRB2-like endophilin B1
SH3GLB2 pro-1287 Recombinant Human SH3-domain GRB2-like endophilin B2
SHC1 pro-883 Recombinant Human SHC-Transforming Protein 1
SIL1 pro-1187 Recombinant Human SIL1
SIRT2 pro-033 Recombinant Human SIrtuin-2
SIRT3 pro-462 Recombinant Human SIrtuin-3
SIRT6 pro-282 Recombinant Human SIrtuin-6
SIT1 pro-928 Recombinant Human Signaling Threshold Regulating Transmembrane Adaptor 1
SIX1 pro-1226 Recombinant Human SIX Homeobox 1
SIX6 pro-1253 Recombinant Human SIX Homeobox 6
SLAMF1 pro-1342 Recombinant Human SLAMF1
SLAMF6 pro-1286 Recombinant Human SLAMF6
SLC4A4 pro-688 Recombinant Human Solute Carrier Family 4, Sodium Bicarbonate Cotransporter, Member 4
SLPI pro-849 Recombinant Human Secretory Leukocyte Peptidase Inhibitor
SMAC/DIABLO pro-614 Recombinant Human SMAC/DIABLO
SMAD2 pro-691 Recombinant Human SMAD Family Member 2
SMAD3 pro-751 Recombinant Human Mothers Against Decapentaplegic Homolog 3
SMAD4 pro-459 Recombinant Human Mothers Against Decapentaplegic Homolog 4
SMNDC1 pro-035 Recombinant Human Survival Motor Neuron Domain Containing 1
SNAP23 pro-659 Recombinant Human Synaptosomal-associated protein 23kDa
SNAP25 pro-573 Recombinant Human Synaptosomal-associated protein 25kDa
SNAP-25 pro-396 Recombinant Synaptosomal-associated protein 25kDa, C.elegans
SNAP25B pro-635 Recombinant Human Synaptosomal-associated protein 25B
SNAPIN pro-663 Recombinant Human SNAP Associated Protein
SNCA pro-393 Recombinant Human Alpha-Synuclein
SNCA 1-60 pro-165 Recombinant Human Alpha-Synuclein 1-60
SNCA 61-140 pro-163 Recombinant Human Alpha-Synuclein 61-140
SNCA 96-140 pro-164 Recombinant Human Alpha-Synuclein 96-140
SNCA A30P pro-158 Recombinant Human Alpha-Synuclein A30P
SNCA A30P/A53T pro-160 Recombinant Human Alpha-Synuclein A30P/A53T
SNCA A53T pro-159 Recombinant Human Alpha-Synuclein A53T
SNCA Delta-NAC pro-161 Recombinant Human Alpha-Synuclein Delta-NAC
SNCA NACP112 pro-162 Recombinant Human Alpha-Synuclein NACP112
CA pro-858 Recombinant Mouse Alpha-Synuclein
SNCB pro-394 Recombinant Human Beta-Synuclein
SNCG pro-395 Recombinant Human Gamma-Synuclein
SNF8 pro-1135 Recombinant Human SNF8, ESCRT-II Complex Subunit
SNIP1 pro-201 Recombinant Human Smad Nuclear Interacting Protein 1
SNPH pro-545 Recombinant Human Syntaphilin
SNRNP25 pro-226 Recombinant Human Small Nuclear Ribonucleoprotein 25kDa
SNRNP70 pro-445 Recombinant Human Small Nuclear Ribonucleoprotein 70kDa
SNRPA1 pro-1015 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide A
SNRPB2 pro-217 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide B
SNRPC pro-1004 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide C
SNRPD pro-997 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D1, D2, D3
SNRPD1 pro-994 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D1
SNRPD2 pro-123 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D2
SNRPD2, Sf9 pro-995 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D2, Sf9
SNRPD3 pro-945 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D3
SNRPD3, Sf9 pro-996 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide D3, Sf9
SNRPE pro-104 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide E
SNRPF pro-041 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide F
SNRPG pro-196 Recombinant Human Small Nuclear Ribonucleoprotein Polypeptide G
SNTA1 pro-1016 Recombinant Human Syntrophin, Alpha 1
SNTN pro-216 Recombinant Human Sentan Cilia Apical Structure Protein
SNUPN pro-866 Recombinant Human Snurportin 1
SNX1 pro-665 Recombinant Human Sorting Nexin 1
SNX3 pro-246 Recombinant Human Sorting Nexin 3
SOD pro-286 Recombinant Human Superoxide Dismutase
SOD His pro-1239 Recombinant Human Superoxide Dismutase His Tag
SOD1 pro-648 Recombinant Human Superoxide Dismutase-1
SOD2 pro-819 Recombinant Human Superoxide Dismutase-2
SODA pro-208 Recombinant E.Coli Superoxide Dismutase
SOSTDC1 pro-426 Recombinant Human Sclerostin Domain Containing 1
SOX2 pro-820 Recombinant Human SRY (sex determining region Y)-box 2
SOX2 PolyR pro-089 Recombinant Human SRY (sex determining region Y)-box 2 Polyarginine-Tag
Sox2-TAT pro-1343 Recombinant Human SRY (sex determining region Y)-box 2 TAT
SOX9 pro-739 Recombinant Human SOX9
SP100 pro-108 Recombinant Human SP100
SPA pro-356 Recombinant Staphylococcal Protein-A
SPA 41kDa pro-774 Recombinant Staphylococcal Protein-A 41kDa
SPA 434a.a. pro-686 Recombinant Staphylococcal Protein A 434 a.a
SPARC pro-582 Recombinant Human Secreted Protein Acidic & Rich in Cysteine
SPG21 pro-677 Recombinant Human Spastic Paraplegia 21
SPIN1 pro-1184 Recombinant Human Spindlin-1
SPINT pro-1296 Recombinant Human Serine Peptidase Inhibitor, Kunitz Type 2
SPOP pro-195 Recombinant Human Speckle-Type POZ Protein
SPSB1 pro-223 Recombinant Human SPRY Domain-Containing SOCS Cox Protein 1
SPSB2 pro-1264 Recombinant Human SPRY Domain-Containing SOCS Cox Protein 2
SQSTM1 pro-806 Recombinant Human Sequestosome 1
SRA1 pro-1274 Recombinant Human Steroid Receptor RNA Activator 1
sRAGE pro-600 Recombinant Human Advanced Glycosylation End Product-Specific Receptor
sRAGE HEK pro-601 Recombinant Human Advanced Glycosylation End Product-Specific Receptor, HEK
SRSF1 pro-1352 Recombinant Human Serine/arginine-Rich Splicing Factor 1
SRGN pro-965 Recombinant Human Serglycin
SRI pro-166 Recombinant Human Sorcin
SRP14 pro-013 Recombinant Human Signal Recognition Particle 14kDa
SRP54 pro-113 Recombinant Human Signal Recognition Particle 54kDa
SSBP1 pro-1408 Recombinant Human Single-Stranded DNA Binding Protein 1
SSR2 pro-1380 Recombinant Human Signal Sequence Receptor, Beta
SSR4 pro-1294 Recombinant Human Signal Sequence Receptor, Delta
SSX1 pro-1379 Recombinant Human Synovial Sarcoma, X Breakpoint 1
STAMBP pro-017 Recombinant Human STAM Binding Protein
STAMBPL1 pro-1354 Recombinant Human STAM Binding Protein Like 1
STAP1 pro-1110 Recombinant Human Signal Transducing Adaptor Family Member 1
STAR pro-979 Recombinant Human Steroidogenic Acute Regulatory Protein
STIM1 pro-620 Recombinant Human Stromal Interaction Molecule 1
STIP1 pro-753 Recombinant Human Stress-Induced-Phosphoprotein 1
STMN1 pro-676 Recombinant Human Stathmin-1
STMN2 pro-752 Recombinant Human Stathmin Like-2
STMN3 pro-838 Recombinant Human Stathmin Like-3
Streptavidin pro-283 Streptavidin
Streptavidin pro-791 Recombinant Streptavidin
Streptavidin, His pro-621 Recombinant Streptavidin, His Tag
Streptavidin-NC pro-338 Recombinant Streptavidin-NC
STX11 pro-1111 Recombinant Human Syntaxin-11
STX12 pro-1099 Recombinant Human Syntaxin-12
STX1A pro-574 Recombinant Human Syntaxin-1A
STX2 pro-1146 Recombinant Human Syntaxin-2
STX3 pro-1082 Recombinant Human Syntaxin-3
STX4 pro-1176 Recombinant Human Syntaxin-4
SUB1 pro-835 Recombinant Human SUB1 Homolog
SUFU pro-938 Recombinant Human Suppressor of Fused Homolog
SUGT1 pro-096 Recombinant Human SGT1
SUMF1 pro-986 Recombinant Human Sulfatase Modifying Factor 1
SUMO1 pro-326 Recombinant Human Small Ubiquitin-Related Modifier 1
SUMO1 His pro-980 Recombinant Human Small Ubiquitin-Related Modifier 1, His Tag
SUMO2 pro-586 Recombinant Human Small Ubiquitin-Related Modifier 2
SUMO2 GST pro-541 Recombinant Human Small Ubiquitin-Related Modifier 2, GST
SUMO3 pro-267 Recombinant Human Small Ubiquitin-Related Modifier 3
SURF1 pro-764 Recombinant Human Surfeit-1
SYCE3 pro-1179 Recombinant Human Synaptonemal Complex Central Element Protein 3
SYF2 pro-969 Recombinant Human SYF2 RNA splicing factor
SYT1 pro-239 Recombinant Human Synaptotagmin I
SYT4 pro-1375 Recombinant Human Synaptotagmin IV
TAC1 pro-1338 Recombinant Human Tachykinin-1
TAC3 pro-716 Recombinant Human Tachykinin-3
TACSTD2 pro-157 Recombinant Human Tumor-Associated Calcium Signal Transducer 2
TAGLN pro-851 Recombinant Human Transgelin
TAGLN2 pro-124 Recombinant Human Transgelin-2
TAGLN3 pro-946 Recombinant Human Transgelin-3
TANK pro-1348 Recombinant Human TRAF Family Member-Associated NFKB Activator
TARDBP pro-1410 Recombinant Human TAR DNA Binding Protein
TAX1BP3 pro-981 Recombinant Human Tax1 Binding Protein 3
TBCA pro-705 Recombinant Human Tubulin Folding Cofactor A
TBCB pro-1127 Recombinant Human Tubulin Folding Cofactor B
TBCC pro-1180 Recombinant Human Tubulin Folding Cofactor C
TBPL1 pro-736 Recombinant Human TBP-Like 1
TBCEL pro-030 Recombinant Human Tubulin Folding Cofactor E-Like
TCEA1 pro-1098 Recombinant Human Transcription Elongation Factor A (SII)- 1
TCEAL1 pro-507 Recombinant Human Transcription Elongation Factor A (SII)-Like 1
TCEAL3 pro-1128 Recombinant Human Transcription Elongation Factor A (SII)-Like 3
TCEAL7 pro-1147 Recombinant Human Transcription Elongation Factor A (SII)-Like 7
TCEAL8 pro-1188 Recombinant Human Transcription Elongation Factor A (SII)-Like 8
TCEB1 pro-1017 Recombinant Human Transcription Elongation Factor B Polypeptide 1
TCEB2 pro-664 Recombinant Human Transcription Elongation Factor B Polypeptide 2
TCL1A pro-726 Recombinant Human T-cell Leukemia/Lymphoma 1A
TCP1 pro-276 Recombinant Human T-Complex 1
TES pro-549 Recombinant Human Testis Derived Transcript
TEV pro-585 Recombinant Tobacco Etch Virus Protease
TFAM pro-095 Recombinant Human Transcription Factor-A
TFB1M pro-903 Recombinant Human Transcription Factor B1, Mitochondrial
TFB2M pro-1259 Recombinant Human Transcription Factor B2, Mitochondrial
TFPI2 pro-860 Recombinant Human Tissue Factor Pathway Inhibitor 2
TGFBI pro-568 Recombinant Human Transforming Growth Factor Beta Induced
TGFBI 182 pro-672 Recombinant Human Transforming Growth Factor Beta Induced 182 a.a.
THAP1 pro-1089 Recombinant Human THAP Domain Containing, Apoptosis Associated Protein 1
THBS1 pro-288 Recombinant Human Thrombospondin
Thrombin pro-339 Human Thrombin
THYN1 pro-270 Recombinant Human Thymocyte Nuclear Protein 1
Thyroglobulin pro-443 Human Thyroglobulin
TIAF1 pro-1211 Recombinant Human TGFB1-Induced Anti-Apoptotic Factor 1
TICAM2 pro-1036 Recombinant Human Toll-Like Receptor Adaptor Molecule 2
TIFA pro-1041 Recombiant Human TRAF-Interacting Protein with Forkhead-Associated Domain
TIRAP pro-1181 Recombinant Human Toll-Interleukin 1 Receptor (TIR) Domain Containing Adaptor Protein
TMOD3 pro-1165 Recombinant Human Tropomodulin 3
TNIP1 pro-005 Recombinant Human TNFAIP3 Interacting Protein 1
TNNI1 pro-1269 Recombinant Human Troponin I Type 1
TNNI2 pro-1283 Recombinant Human Troponin I Type 2
TNNT2 pro-703 Recombinant Human Troponin T Type 2, Cardiac Isoform 3
TOLLIP pro-228 Recombinant Human Toll Interacting Protein
TPD52L1 pro-442 Recombinant Human Tumor Protein D52 L1
TPM1 pro-469 Recombinant Human Tropomyosin-1
TPM2 pro-069 Recombinant Human Tropomyosin-2
TPM3 pro-1020 Recombinant Human Tropomyosin-3
TPM4 pro-187 Recombinant Human Tropomyosin-4
TPRKB pro-1185 Recombinant Human TP53RK Binding Protein
TPT1 pro-776 Recombinant Human Tumor Protein Translationally-Controlled 1
TRAF1 pro-834 Recombinant Human TNF receptor-Associated Factor 1
TRAF2 pro-685 Recombinant Human TNF receptor-Associated Factor 2
Transferrin pro-747 Recombinant Human Transferrin
TRAPPC2 pro-1272 Recombinant Human Trafficking Protein Particle Complex 2
TRAPPC3 pro-1056 Recombinant Human Trafficking Protein Particle Complex 3
TRAPPC4 pro-1273 Recombinant Human Trafficking Protein Particle Complex 4
TREM1 pro-457 Recombinant Human Triggering Receptor Expressed on Myeloid Cells 1
TRIM21 pro-328 Recombinant Human Tripartite Motif Containing 21 (RO52)
Troponin 1 pro-341 Recombinant Human fast skeletal Troponin 1
Troponin I-C pro-344 Recombinant Human Cardiac Troponin I-C Complex
Troponin I-C pro-345 Recombinant Single Chain Cardiac Troponin I-C
Troponin I-C pro-346 Recombinant Single Chain Cardiac Troponin I-C 2nd generation
Troponin-C pro-322 Recombinant Human Cardiac Troponin-C
Troponin-C His pro-959 Recombinant Human Cardiac Troponin-C His
Troponin-I pro-324 Recombinant Human Cardiac Troponin-I
Troponin-T pro-342 Human Cardiac Troponin-T
TROVE2 pro-329 Recombinant Human TROVE Domain Family Member 2
TROVE2 His pro-110 Recombinant Human TROVE Domain Family Member 2 His Tag
Trypsin pro-770 Recombinant Human Trypsin
Trypsin Yeast pro-786 Recombinant Human Trypsin, Yeast
TSC22D3 pro-1254 Recombinant Human TSC22 Domain Family, Member 3
TSEN15 pro-144 Recombinant Human tRNA Splicing Endonuclease 15
TSG101 pro-805 Recombinant Human Tumor Susceptibility Gene 101
TSN pro-271 Recombinant Human Translin
TSNAX pro-1292 Recombinant Human Translin-Associated Factor X
TSSC4 pro-1021 Recombinant Human Tumor Suppressing Subtransferable Candidate 4
TTC1 pro-1160 Recombinant Human Tetratricopeptide Repeat Domain 1
TTC32 pro-1246 Recombinant Human Tetratricopeptide Repeat Domain 32
TTC33 pro-1217 Recombinant Human Tetratricopeptide Repeat Domain 33
TUBB3 pro-1388 Recombinant Human Tubulin, Beta 3 Class III
TUBG1 pro-982 Recombinant Human Tubulin Gamma 1
TULP1 pro-1191 Recombinant Human Tubby Like Protein 1
TWF1 pro-1003 Recombinant Human Twinfilin-1
TXN1 pro-334 Recombinant E.Coli Thioredoxin
TXN1 pro-569 Recombinant Human Thioredoxin
TXN1, His pro-784 Recombinant E.Coli Thioredoxin, His
TXN1, His pro-804 Recombinant Human Thioredoxin His Tag
TXN2 pro-625 Recombinant Human Thioredoxin-2
TXNDC12 pro-1133 Recombinant Human Thioredoxin Domain Containing 12
TXNDC17 pro-1055 Recombinant Human Thioredoxin Domain Containing 17
TXNL1 pro-084 Recombinant Human Thioredoxin-Like 1
TXNL4A pro-1100 Recombinant Human Thioredoxin-Like 4A
TXNL4B pro-238 Recombinant Human Thioredoxin-Like 4B
TYW5 pro-1315 Recombinant Human tRNA-yW Synthesizing Protein 5
U. Urealyticum pro-670 Recombinant Ureaplasma Urealyticum Parvum
UBD pro-927 Recombinant Human Ubiquitin-D
Ubiquitin pro-314 Recombinant Human Ubiquitin
Ubiquitin Biotin pro-629 Recombinant Human Ubiquitin Biotin
Ubiquitin G76A pro-280 Recombinant Human Ubiquitin Gly76 to Ala76 mutation
Ubiquitin GST pro-735 Recombinant Human Ubiquitin, GST Tag
Ubiquitin K48R pro-372 Recombinant Human Ubiquitin Lys 48 to Arg 48 mutation
UBL3 pro-230 Recombinant Human Ubiquitin-Like 3
UBL4A pro-1043 Recombinant Human Ubiquitin-Like 4A
UBL5 pro-231 Recombinant Human Ubiquitin-Like 5
UBTD2 pro-1203 Recombinant Human Ubiquitin Domain Containing 2
UFM1 pro-125 Recombinant Human Ubiquitin-Fold Modifier 1
UFSP1 pro-1320 Recombinant Human UFM1-Specific Peptidase 1
ULBP2 pro-1134 Recombinant Human UL16 Binding Protein 2
Ulinastatin pro-608 Recombinant Human Urinary Trypsin Inhibitor (UTI)
Ulinastatin pro-321 Human Urinary Trypsin Inhibitor (UTI)
UNC119B pro-1034 Recombinant Human UNC-119 Homolog B
UPK2 pro-479 Recombinant Human Uroplakin 2
UPK3A pro-988 Recombinant Human Uroplakin 3A
UQCRC2 pro-1224 Recombinant Human Ubiquinol-Cytochrome C Reductase Core Protein II
URM1 pro-188 Recombinant Human Ubiquitin Related Modifier 1
USH1C pro-706 Recombinant Human Usher Syndrome 1C
USP14 pro-016 Recombinant Human Ubiquitin Specific Peptidase 14
UTP23 pro-1235 Recombinant Human UTP23, Small Subunit Processome Component
UXT pro-1312 Recombinant Human Ubiquitously-Expressed, Prefoldin-Like Chaperone
VAMP1 pro-577 Recombinant Human Synaptobrevin-1
VAMP2 pro-578 Recombinant Human Synaptobrevin-2
VAMP3 pro-652 Recombinant Human Synaptobrevin-3
VAMP4 pro-714 Recombinant Human Vesicle-Associated Membrane Protein 4
VAMP5 pro-681 Recombinant Human Synaptobrevin-5
VAMP7 pro-1194 Recombinant Human Vesicle-Associated Membrane Protein 7
VAMP8 pro-660 Recombinant Human Synaptobrevin-8
VAPA pro-779 Recombinant Human VAMP Associated Protein A, 33kDa
VAPB pro-014 Recombinant Human VAMP Associated Protein B and C
VASP pro-191 Recombinant Human Vasodilator-Stimulated Phosphoprotein
VAT1 pro-1011 Recombinant Human Vesicle Amine Transport Protein 1 Homolog
VBP1 pro-1325 Recombinant Human Von Hippel-Lindau Binding Protein 1
VCAM1 pro-386 Recombinant Human Vascular cell adhesion molecule 1
VDR pro-205 Recombinant Human Vitamin D Receptor
VHL pro-440 Recombinant Human Von Hippel-Lindau Protein
Vimentin pro-309 Recombinant Human Vimentin
Vimentin GST pro-734 Recombinant Human Vimentin, GST Tag
VOPP1 pro-200 Recombinant Human Vesicular Overexpressed in Cancer, Prosurvival Protein 1
VPS24 pro-872 Recombinant Human Vacuolar Protein Sorting 24
VPS25 pro-1054 Recombinant Human Vacuolar Protein Sorting 25
VPS26A pro-1161 Recombinant Human Vacuolar Protein Sorting 26A
VPS28 pro-730 Recombinant Human Vacuolar Protein Sorting 28
VPS29 pro-1075 Recombinant Human Vacuolar Protein Sorting 29
mVPS29 pro-1066 Recombinant Mouse Vacuolar Protein Sorting 29
VRK3 pro-1130 Recombinant Human Vaccinia Related Kinase 3
VSNL1 pro-723 Recombinant Human Visinin-Like Protein-1
VSNL1 His pro-602 Recombinant Human Visinin-Like Protein-1 His Tag
VSTM2L pro-1018 Recombinant Human V-Set and Transmembrane Domain Containing 2 Like
VTA1 pro-1044 Recombinant Human Vps20-Associated 1 Homolog
VTI1B pro-1115 Recombinant Human Vesicle Transport Through Interaction with t-SNAREs Homolog 1B
WBP2 pro-1208 Recombinant Human WW Domain Binding Protein 2
WDR5 pro-863 Recombinant Human WD Repeat Domain 5
WHSC2 pro-062 Recombinant Human Wolf-Hirschhorn Syndrome Candidate 2
WIBG pro-864 Recombinant Human within BCGN Homolog
WIF1 pro-684 Recombinant Human WNT Inhibitory Factor 1
WLS pro-1402 Recombinant Human Wntless
XAGE1A pro-1256 Recombinant Human X Antigen Family, Member 1A
XG pro-1395 Recombinant Human XG Blood Group
XPA pro-026 Recombinant Human Xeroderma Pigmentosum, Complementation Group A
YEATS4 pro-1019 Recombinant Human YEATS Domain Containing 4
yTXN1 pro-333 Recombinant Yeast Thioredoxin
重庆市华雅干细胞技术有限公司
2025 版权所有 © 重庆市华雅干细胞技术有限公司 备案号:渝ICP备14000349号-4 sitemap.xml 管理登陆 技术支持:化工仪器网
地址:重庆市江北区金渝大道153号8栋20-14 传真:023-63419626 邮件:sales@ys-bio.com
重庆市华雅干细胞技术有限公司主要经营干细胞研究 干细胞治疗产品 生物试剂 实验耗材 药物研发等产品。

关注我们
